SecReT6
Protein ID: 386324500
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2043
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2416676..2417161 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDG0AY85
KEGG IDsbb:Sbal175_2043
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-32, Aligned region: 15..146
Protein Sequence: 161 a.a.     [Download]
>gi|386324500|ref|YP_006020617.1| type VI secretion lipoprotein [Shewanella baltica BA175]
MFNYKALLGVVMSMSLIGCQTFYSAFPPSTTMNFRIANDINPDSDGRASPVIVNVYELASKTVFENQDFF
ALYDNASETLRTDLIKKDELVFEPGARLEYEMFLQPTTKAVAILVAYRDVEGARWHAVIDADPTGYDDAY
VYIDKLAVYIRDRDTEAATKR
 
Nucleotide Sequence: 486 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2416676-2417161 Shewanella baltica BA175 chromosome, complete genome
ATGTTTAATTATAAAGCATTACTAGGCGTAGTGATGTCTATGAGCTTAATCGGATGTCAAACTTTTTATT
CGGCTTTTCCGCCTTCAACAACGATGAACTTTCGTATTGCTAACGATATTAATCCTGATAGTGATGGTCG
AGCTTCGCCGGTTATTGTAAATGTGTATGAGTTAGCATCAAAAACGGTCTTTGAGAATCAGGACTTTTTT
GCACTATATGATAATGCGAGCGAAACATTAAGAACGGACTTAATCAAAAAAGATGAATTAGTTTTTGAGC
CAGGTGCTCGTTTAGAGTATGAAATGTTTTTACAACCAACAACGAAAGCTGTTGCGATTTTAGTTGCCTA
CAGGGATGTAGAGGGCGCACGTTGGCATGCTGTAATTGATGCGGATCCTACTGGATATGATGATGCGTAT
GTTTATATCGATAAACTAGCGGTCTATATCAGAGACCGAGACACCGAAGCGGCAACGAAGCGCTAA