SecReT6
Protein ID: 386324501
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2044
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2417185..2418513 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDG0AY86
KEGG IDsbb:Sbal175_2044
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.30E-146, Aligned region: 19..441
Protein Sequence: 442 a.a.     [Download]
>gi|386324501|ref|YP_006020618.1| type VI secretion protein [Shewanella baltica BA175]
MSHFSKIAWTEGTFLRPQHFQQQERYFSNMQQKCNAMLSLFPWGVSDLEIDDKATKFSQFGITSLQGILP
DGTLLELPMNDLIPSVIEIPKSCREQQVFLCLAFEKVNSVDIATADSTTITRYQFSDQLVSDNTLSEESA
ELLQVAQLRLLLKLESEDRGGYIAMPIAKIKEVSEHGEIKLDKKFIPPTINIQRNGELKGFIQETLGMLR
QRAEALAARISRGQGNANSIADFLMLQVLNRYEPIFQHIKQSDGQHPEYLYQHAITMLGELATFTSRDKR
APEFPQYNHTDLATVFGNLSVILNQTLSVVLEQTAIALPIEQAKFGIMVSPLTDKTLLEYAQFVLAVSAD
LPADDVRKHLPARLKIGPVEHIRELVNNQLPGIAVTGLPVAPRQVPYHAGFHYFQLDKSGIYWEKLSNSG
GLALHLSGNYPGLKLELWAIKS
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2417185-2418513 Shewanella baltica BA175 chromosome, complete genome
ATGAGTCATTTTAGCAAGATAGCTTGGACTGAAGGAACGTTTTTACGTCCACAACACTTTCAGCAGCAAG
AACGTTACTTTTCTAATATGCAGCAAAAGTGCAATGCGATGTTGTCACTTTTCCCTTGGGGAGTCTCAGA
TTTAGAAATTGATGACAAAGCAACAAAGTTTTCTCAGTTTGGTATTACTTCATTACAGGGGATTTTACCT
GATGGGACATTGCTTGAGTTGCCAATGAATGACTTAATACCATCTGTTATTGAGATACCAAAATCGTGCC
GTGAGCAACAGGTATTTCTGTGTCTTGCCTTCGAGAAGGTGAATAGCGTTGATATTGCAACCGCCGATAG
TACAACAATAACTCGCTATCAATTTTCAGACCAATTGGTTTCGGATAACACATTATCAGAAGAAAGTGCA
GAGCTACTACAGGTTGCACAGTTGCGTTTACTGCTGAAGCTCGAGAGTGAAGACCGCGGTGGCTATATTG
CTATGCCTATTGCAAAAATAAAAGAGGTTAGCGAGCACGGTGAAATTAAATTGGATAAGAAATTCATTCC
ACCAACGATTAACATTCAACGCAACGGTGAATTAAAAGGATTTATTCAGGAGACGTTAGGCATGTTGAGA
CAACGTGCTGAAGCGTTGGCCGCTCGTATCTCAAGGGGGCAAGGAAACGCCAACTCGATAGCCGATTTTT
TAATGCTGCAGGTGCTTAATCGATATGAGCCTATTTTTCAGCATATTAAGCAAAGTGATGGACAGCATCC
AGAATATCTTTATCAACATGCTATAACCATGCTTGGAGAATTGGCGACTTTTACTAGCCGAGATAAGCGA
GCACCTGAATTCCCGCAGTATAACCATACTGATTTGGCCACAGTATTTGGCAACTTATCAGTGATATTAA
ACCAAACGTTAAGTGTTGTATTAGAACAAACAGCCATTGCGTTACCAATTGAACAAGCTAAGTTTGGCAT
TATGGTATCTCCATTGACGGATAAAACTCTGTTGGAGTATGCGCAGTTTGTATTGGCTGTTAGTGCAGAT
TTACCAGCCGATGATGTGCGTAAACACTTGCCGGCGAGATTAAAAATTGGACCCGTTGAACATATTAGAG
AGCTGGTCAATAACCAATTACCAGGCATTGCTGTGACAGGATTACCGGTGGCGCCAAGACAAGTACCTTA
TCATGCAGGTTTCCATTATTTTCAGTTAGATAAGAGCGGAATATATTGGGAAAAACTCAGTAATAGTGGT
GGTCTTGCTTTGCATTTATCTGGTAATTATCCGGGATTAAAGCTGGAATTGTGGGCAATTAAATCTTGA