SecReT6
Protein ID: 386324502
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2045
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2418553..2419863 [+]
ProductDotU family type IV / VI secretion system protein
NoteTssL
UniProt IDG0AY87
KEGG IDsbb:Sbal175_2045
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.60E-63, Aligned region: 58..263
DUF2077 [PF09850], Evalue: 1.60E-63, Aligned region: 399..429
OmpA [PF00691], Evalue: 2.10E-12, Aligned region: 330..428
Protein Sequence: 436 a.a.     [Download]
>gi|386324502|ref|YP_006020619.1| DotU family type IV / VI secretion system protein [Shewanella baltica BA175]
MSDKTIMKPRPGARKADPVGTNASRDDVSHQSDKTQMAIPKAPTSFQSGQLYLSVSDNVLIDEAGLLFSL
VAPIRSTQQHQDVLGLKKHCIYLIQQYELQLRAKQISSELIERARYCVCSFLDELVLNTAWGENSDWGTE
SLLSTFHNETFGGEYFFTLLESAIASPKENLMQLELQYLCLSLGFIGKMRVETNGYEKLELIKDRAYKAI
RSQKGEPPRDLSPHWHSDAKNVNHLENRVPLWVMCSFVGVLLLSVYMYLSYKLNSQSDAVNRQMNSLIVD
NTPQALQVSASTVHEGARLQQLLQTEIGMQLLEVIELPDRVRIRVGLHHLFTTGGTDINEGFQPVIVKIA
RALEGTKGRILVNGYTDDQPIFTSRYPSNWHLSLARANAMADSLAAGADLHGRLQPEGRGEAEPVAPNDT
PENRALNRRVEIDLLK
 
Nucleotide Sequence: 1311 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2418553-2419863 Shewanella baltica BA175 chromosome, complete genome
ATGTCAGATAAGACAATAATGAAGCCTCGACCAGGAGCAAGAAAGGCTGATCCTGTTGGCACAAATGCAA
GTCGTGATGACGTTAGTCATCAGAGCGACAAAACCCAAATGGCAATACCAAAGGCGCCAACATCATTTCA
AAGTGGTCAATTGTACTTGTCTGTGAGTGATAATGTGCTAATAGACGAGGCAGGCCTTCTTTTTTCTTTA
GTCGCGCCAATCCGAAGTACTCAACAACATCAAGATGTATTAGGACTTAAGAAACACTGTATTTATTTAA
TTCAGCAGTACGAATTGCAATTGAGAGCTAAGCAAATATCCTCTGAATTAATAGAGCGAGCTCGTTACTG
TGTATGCAGTTTTCTGGATGAACTCGTGCTCAACACCGCCTGGGGTGAGAACAGTGATTGGGGGACCGAG
AGTCTGCTTTCTACTTTTCATAACGAAACATTTGGTGGAGAGTATTTTTTTACTCTTTTAGAAAGTGCTA
TCGCTTCCCCAAAAGAAAATTTAATGCAGTTAGAGTTGCAATACCTTTGTCTATCTCTTGGCTTTATTGG
GAAAATGAGGGTTGAAACAAATGGCTATGAAAAACTAGAACTTATAAAAGACCGCGCTTATAAGGCTATA
CGTAGTCAAAAAGGTGAACCTCCGAGAGATTTATCACCACATTGGCATTCCGATGCAAAGAATGTTAATC
ATCTAGAAAATCGTGTACCACTGTGGGTAATGTGCTCTTTTGTCGGTGTTTTATTACTCAGTGTATATAT
GTATTTAAGTTACAAACTGAATTCACAGTCTGATGCAGTCAATCGGCAGATGAATTCTTTAATTGTAGAT
AATACGCCACAAGCGCTTCAGGTTTCTGCGTCTACTGTACATGAAGGTGCACGTTTGCAACAGTTACTGC
AAACAGAAATTGGCATGCAATTACTCGAGGTTATTGAGTTACCGGATCGCGTGAGAATTCGGGTGGGACT
TCATCATCTTTTTACAACGGGCGGGACAGATATTAATGAAGGATTTCAGCCTGTTATTGTAAAAATAGCG
AGAGCTCTAGAAGGGACCAAAGGCCGTATTTTAGTGAATGGTTATACCGATGATCAACCCATATTTACAA
GCAGATATCCATCAAATTGGCACCTTTCATTAGCAAGAGCAAATGCGATGGCAGACAGTTTAGCCGCTGG
AGCAGATTTACATGGACGTTTACAGCCAGAGGGACGTGGTGAGGCAGAACCTGTTGCACCAAACGATACC
CCTGAAAATCGGGCTTTAAATCGTCGTGTCGAAATAGACTTATTGAAATAA