SecReT6
Protein ID: 386324506
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2049
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2424951..2426042 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDG0AY91
KEGG IDsbb:Sbal175_2049
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.80E-16, Aligned region: 66..127
Protein Sequence: 363 a.a.     [Download]
>gi|386324506|ref|YP_006020623.1| type VI secretion-associated protein, ImpA family [Shewanella baltica BA175]
MDYDDIIDFSLLIKNVNELAPSGVDPRTDISPSSQYYRLKDIRSNARANERKLLVEEDDFQSLVGDWRPI
IDEIPNALVHEVKDLEFAAWLIEALCRVYGFRGLAIGFKTAHLIIENFWDSLYPSPDDDDIEFRIASLIG
LNGYDGDGALITPIMSIPITQDTSSGCYATWQYIRALDLSRENEDKQRKKTDNGVISVEQINRAVSESSK
EFYGELVEQLNSAIDEFEQLSKNMDRVMGQPQPTTAISKSLQKCLDSVKYLAADKLAVISSEVNDSIDIN
IDGETQTIGAVDNQLQTRQQVIRSLQQAAEFFRKTEPHSPMSYSLEQVIRWSSLTLPELLQELIDDSNSR
NGYFKLTGITETK
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2424951-2426042 Shewanella baltica BA175 chromosome, complete genome
ATGGACTATGATGATATAATTGATTTTTCATTACTGATAAAAAATGTTAATGAGTTGGCTCCTTCAGGGG
TCGATCCTCGCACAGATATATCTCCGAGTTCTCAGTATTATCGATTAAAAGATATTCGTAGTAATGCTAG
AGCGAATGAACGGAAGTTGCTGGTAGAAGAAGATGACTTTCAGTCTTTAGTTGGGGATTGGCGACCAATT
ATTGATGAAATACCAAATGCACTTGTGCACGAGGTAAAGGATCTAGAGTTTGCAGCTTGGTTAATCGAAG
CATTGTGTCGTGTTTATGGTTTCAGAGGGCTTGCGATTGGCTTTAAAACTGCGCACCTTATCATAGAGAA
CTTTTGGGATAGTTTATATCCGAGTCCTGATGATGACGATATTGAATTTCGCATTGCATCCTTAATTGGA
CTTAACGGCTATGATGGTGATGGTGCATTAATTACACCAATTATGAGTATTCCGATTACTCAAGATACAA
GTTCTGGTTGTTATGCTACTTGGCAATATATTCGAGCATTAGACCTATCTAGAGAAAATGAAGATAAACA
ACGGAAAAAAACAGATAATGGTGTTATAAGTGTCGAGCAAATTAATAGAGCTGTTTCTGAATCCTCTAAA
GAGTTTTATGGGGAGTTAGTTGAACAGTTAAATAGTGCTATTGATGAGTTTGAACAGTTATCAAAAAATA
TGGATAGAGTTATGGGACAACCGCAACCTACCACAGCCATTAGCAAATCACTACAGAAATGTCTTGATTC
TGTTAAATATCTTGCGGCCGATAAATTGGCAGTTATTAGTTCAGAAGTTAATGATAGCATTGATATTAAT
ATTGATGGCGAAACGCAGACAATCGGTGCTGTAGATAATCAGCTCCAAACACGGCAACAAGTTATTAGAA
GTTTACAGCAGGCTGCTGAATTTTTTAGAAAAACTGAACCTCATTCGCCTATGTCTTATTCACTAGAGCA
AGTTATTCGTTGGAGTAGCTTAACTTTGCCTGAGTTATTGCAAGAGCTTATAGATGATAGTAATAGTCGT
AATGGGTATTTTAAACTAACAGGCATAACTGAAACTAAGTAA