SecReT6
Protein ID: 386324507
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2050
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2426102..2426602 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDG0AY92
KEGG IDsbb:Sbal175_2050
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.00E-61, Aligned region: 8..162
Protein Sequence: 166 a.a.     [Download]
>gi|386324507|ref|YP_006020624.1| type VI secretion protein [Shewanella baltica BA175]
MESIHSKLSRVRKPRVHITYDVETEGASVKKELPFVVGVMGDFAGHNTEALKPLKDRRFVQIDRDNFDDV
LRRMNPKLNFKVDNKLANDDSQFAVELEFKSMQDFEPAAIVRQVAPLDKLMATRNKLRDLMTKIDRSEEL
ENILERVLNNNEDLQKLAQELSLEDK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2426102-2426602 Shewanella baltica BA175 chromosome, complete genome
ATGGAAAGTATTCACAGTAAATTATCACGAGTTAGGAAGCCAAGAGTTCATATAACTTATGATGTCGAAA
CAGAAGGAGCTTCGGTTAAAAAAGAACTGCCGTTTGTTGTTGGTGTTATGGGCGATTTTGCGGGCCATAA
TACAGAGGCTTTGAAACCCTTGAAAGATCGCCGTTTTGTGCAAATAGACCGGGATAATTTTGATGACGTT
TTACGTCGCATGAATCCAAAATTAAATTTTAAAGTTGATAATAAGCTCGCGAATGATGATAGCCAATTTG
CAGTAGAACTTGAGTTTAAATCGATGCAGGATTTTGAACCTGCAGCGATTGTTAGGCAAGTTGCACCTTT
AGATAAGTTAATGGCTACTCGTAATAAGTTACGTGATCTCATGACTAAAATTGATAGGTCAGAAGAACTT
GAAAACATTCTTGAACGAGTGCTTAACAATAACGAAGATCTGCAGAAGTTAGCGCAGGAACTGAGTTTAG
AGGATAAATAA