SecReT6
Protein ID: 386324508
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2051
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2426604..2428097 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDG0AY93
KEGG IDsbb:Sbal175_2051
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.80E-188, Aligned region: 63..493
Protein Sequence: 497 a.a.     [Download]
>gi|386324508|ref|YP_006020625.1| type VI secretion protein EvpB [Shewanella baltica BA175]
MSMEALAEQHDNAQVETSSLLDMAIGATKQTEATRAEELIRTLTEEALNGTVSWNKNLTVTFNEAIERLD
EAISSQLSAIMHTEAFQKLEGSWRGLNHLVSNSETSSTLKIRLMSMTKKELYKDLSKAVEFDQSQTFKKV
YEAEFGTPGGEPYGALIGDYEFTNHPEDIETLTYMSNVAAAGFCPFLSSASPTMFGFDEWTELSKPRDLE
KIFESLEYTKWRSFRESEDSRFVTLTMPRVLGRLPYGNATCPVEEFGFEEFELDPIKKVAITADHADYCW
MNAAYVLGSRLTNAFSQYSFCTAIRGAEGGGKVEGLPSHIFMSDDGDPDLKCPTEIGITDRREAELGKLG
FLPLCHYKNTDYAVFFGAQTAQKPHKYDSPEATANAAISARLPYLMATSRFAHYLKVLARDKIGSFMEAE
DVEVWLNRWILSYVNASEGGGQEVRARYPLADAKVQVKEIPGRPGSYNAVAWLKPWLQLEELSTSLRLVA
KIPQIGG
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2426604-2428097 Shewanella baltica BA175 chromosome, complete genome
ATGAGCATGGAAGCATTAGCTGAACAACACGATAATGCGCAAGTGGAAACGTCCTCTTTATTGGACATGG
CTATTGGCGCAACCAAGCAAACGGAAGCAACTCGTGCTGAGGAATTAATCCGTACTTTAACGGAGGAAGC
GCTTAACGGTACCGTATCTTGGAATAAAAACTTAACGGTTACCTTTAATGAAGCAATCGAAAGGCTGGAT
GAAGCAATTTCTAGCCAATTATCTGCCATCATGCATACTGAGGCTTTTCAAAAACTGGAAGGTTCTTGGC
GTGGTTTGAATCATTTAGTCAGTAATTCAGAAACGAGTTCAACGCTAAAAATTCGTTTAATGAGTATGAC
AAAAAAAGAGCTTTATAAAGATTTAAGTAAAGCTGTTGAGTTTGACCAAAGTCAAACATTCAAAAAAGTA
TATGAAGCTGAGTTTGGAACTCCTGGTGGTGAGCCTTATGGGGCGCTGATTGGTGATTATGAATTTACCA
ATCATCCTGAGGATATTGAGACATTAACCTATATGTCTAACGTCGCCGCCGCAGGTTTTTGTCCTTTCCT
TTCATCTGCTTCTCCAACTATGTTTGGATTTGACGAGTGGACAGAATTATCTAAACCCCGTGATTTAGAG
AAGATATTCGAGTCTCTTGAATATACGAAATGGCGTTCTTTCCGTGAGAGTGAAGATTCTCGATTTGTCA
CACTAACTATGCCTCGAGTATTAGGTCGTTTGCCATATGGTAATGCGACATGTCCAGTAGAAGAATTTGG
TTTTGAAGAGTTTGAGTTAGACCCTATTAAAAAGGTCGCTATAACTGCTGATCATGCTGATTATTGCTGG
ATGAATGCAGCTTATGTACTGGGTAGCCGTTTAACTAACGCATTTTCTCAATATAGTTTCTGTACTGCTA
TTCGTGGCGCCGAAGGTGGTGGAAAAGTAGAAGGTTTACCAAGTCATATCTTTATGAGTGATGACGGTGA
TCCAGATCTGAAGTGTCCTACTGAAATAGGGATCACGGATAGACGAGAAGCTGAATTAGGTAAACTAGGG
TTTTTACCGCTATGCCATTATAAAAATACGGATTACGCAGTATTTTTTGGTGCACAAACAGCTCAGAAAC
CCCATAAGTATGATAGCCCTGAAGCTACGGCAAATGCGGCTATTTCAGCTCGCTTACCATACTTAATGGC
GACATCACGTTTCGCTCACTACTTGAAAGTTTTAGCTCGAGATAAAATCGGTAGCTTCATGGAAGCTGAA
GATGTTGAAGTCTGGTTAAATCGCTGGATCTTAAGCTATGTGAATGCTTCAGAAGGTGGCGGACAGGAAG
TGAGAGCGCGTTATCCTTTAGCTGATGCGAAAGTACAAGTTAAAGAAATTCCTGGTCGTCCTGGATCATA
TAATGCGGTTGCATGGTTAAAGCCTTGGCTTCAACTTGAAGAATTGTCAACGTCTTTACGATTAGTTGCA
AAGATCCCACAAATCGGTGGCTAA