SecReT6
Protein ID: 386324509
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2052
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2428170..2429708 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDG0AY94
KEGG IDsbb:Sbal175_2052
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.10E-161, Aligned region: 73..505
Protein Sequence: 512 a.a.     [Download]
>gi|386324509|ref|YP_006020626.1| type VI secretion protein EvpB [Shewanella baltica BA175]
MFNEVNFVSEDIFLSESNDPIENRATYSDITRRGVLARFLREDNPALAIVYWLENVENMTNIEIEHIVPS
LCRSISAIDELINAQLNEILHHSILQELEASWRGVLYLTEQAGIYDREQKTKIKLISLSWTELSKDVTRA
IDFDQSEFFKLIYSNEFDMPGGEPFGVIVGDYKVSHIIRPGHAVNDLDILKDVTRTAAAAFSPFICSAHP
SLFGVDDFSQLGQVTDIGNQFKQIEYIKWHALREMDDSRFLGIVLPEVLMRSPYKDDGSRIECFVFKENL
SRPEKDYLWGNAAFAFAAVLLRAYCESGWFGQIRGVKSGSHSFGLVSGLPACQYETDIYQKSNKPSVSLL
VSHRFEAELSDNGFIPLSAVPYSDFFAFYNNASVQQAKITNKLVVNVNHRLSAMLQYILCVARFAHYIKV
MGRDKIGGYHSAQECEQDMQKWLHKYTTATEDASDEIRARFPLRAARIEVKEKRGKPGQFYSIIHLQPHF
QLDQMVTTVRLVAELSPKQNSI
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2428170-2429708 Shewanella baltica BA175 chromosome, complete genome
ATGTTCAATGAGGTTAACTTTGTCTCAGAAGATATTTTTCTATCTGAGTCAAATGATCCGATTGAAAATC
GTGCCACATACTCTGATATTACGCGCAGAGGTGTACTTGCGCGTTTTTTACGAGAAGACAATCCTGCACT
AGCAATAGTATATTGGTTAGAGAACGTGGAAAATATGACTAACATAGAGATTGAACATATAGTTCCATCT
CTATGCCGGTCTATTTCTGCAATTGATGAGCTAATCAACGCTCAGCTTAATGAGATATTGCATCATTCAA
TATTGCAAGAATTAGAAGCGAGTTGGAGAGGGGTTTTATATCTCACCGAGCAAGCTGGCATCTATGATAG
GGAACAAAAGACCAAGATAAAATTGATTTCTTTATCTTGGACTGAGCTATCAAAGGATGTTACAAGAGCA
ATTGATTTTGACCAAAGTGAATTTTTTAAGCTGATATATAGCAATGAATTCGATATGCCAGGTGGCGAAC
CGTTTGGTGTTATTGTTGGGGATTATAAGGTTAGTCATATTATCCGCCCAGGGCATGCTGTAAATGATCT
TGATATTTTAAAAGATGTTACTCGAACGGCTGCAGCGGCTTTTTCTCCATTTATTTGTTCAGCTCATCCA
TCTTTATTTGGCGTTGATGATTTCTCCCAATTAGGACAAGTAACAGATATTGGCAATCAATTTAAACAAA
TTGAATATATAAAATGGCATGCTTTAAGAGAAATGGACGATTCTCGCTTTCTTGGTATTGTGCTACCTGA
AGTTCTAATGAGAAGCCCATATAAAGATGACGGTTCAAGAATAGAATGCTTTGTTTTTAAAGAAAATTTA
TCTAGGCCAGAAAAAGATTATCTTTGGGGAAATGCGGCTTTTGCTTTTGCTGCAGTACTATTACGAGCAT
ATTGTGAATCTGGTTGGTTTGGTCAAATACGCGGAGTTAAGTCGGGTAGTCATAGTTTTGGTCTTGTAAG
TGGATTACCTGCATGTCAGTATGAAACTGATATATATCAAAAATCTAATAAGCCGTCTGTAAGTTTACTT
GTGAGCCATCGGTTTGAAGCTGAATTATCCGATAATGGATTTATTCCATTGTCAGCCGTTCCATACAGTG
ATTTTTTTGCATTTTATAATAATGCCTCTGTTCAGCAGGCTAAAATAACAAATAAATTGGTCGTTAATGT
TAATCATAGATTGTCAGCAATGCTGCAGTATATTTTATGTGTTGCGAGATTTGCCCATTATATAAAAGTT
ATGGGGCGAGATAAGATCGGTGGATATCATTCAGCACAAGAATGTGAGCAGGATATGCAAAAGTGGTTAC
ATAAATACACAACTGCGACTGAAGATGCATCCGACGAAATTAGAGCACGATTTCCATTGCGAGCAGCAAG
GATAGAGGTTAAGGAAAAACGTGGTAAGCCAGGACAGTTCTATTCAATAATTCATTTGCAACCACATTTT
CAGTTGGACCAAATGGTAACGACTGTAAGATTAGTTGCTGAGTTGTCACCAAAGCAAAATTCAATCTAA