SecReT6
Protein ID: 386324510
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2053
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2429725..2430522 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDG0AY95
KEGG IDsbb:Sbal175_2053
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.10E-29, Aligned region: 139..257
TPR_19 [PF14559], Evalue: 3.50E-06, Aligned region: 7..63
TPR_19 [PF14559], Evalue: 3.50E-06, Aligned region: 111..122
TPR_14 [PF13428], Evalue: 0.0062, Aligned region: 7..36
TPR_14 [PF13428], Evalue: 0.0062, Aligned region: 33..71
Protein Sequence: 265 a.a.     [Download]
>gi|386324510|ref|YP_006020627.1| virulence protein SciE type [Shewanella baltica BA175]
MKKLNDLIKQGKLNLACEYCKEALREDPINAQLRAIYVELLCINGDLESADNQLDMIIRQHPDFLLGAVN
LRQLIRADQARLDFYRGGMTANLFQESDDIFEKTIRVNLAMLENNIDAATSLVFEIENDREKVLASVNNN
SIDDIRDLDDVLAGYVEIYGTDGKFYLAKFSEIEHFTVHKAESIIDSVWRRIDISIENGPSGEAFLPLTY
VSSEDESSRLGKDTDWLQKGEFVATGTGLKMWLVGDEVLPITAISSFEKMASCSA
 
Nucleotide Sequence: 798 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2429725-2430522 Shewanella baltica BA175 chromosome, complete genome
ATGAAAAAGTTAAATGATTTAATTAAGCAAGGAAAGCTAAATTTGGCTTGCGAATACTGTAAGGAGGCGT
TAAGAGAGGATCCCATCAATGCTCAGTTACGCGCTATTTATGTAGAGTTACTATGTATCAATGGAGATTT
AGAGTCAGCTGATAATCAATTAGACATGATTATTCGGCAACATCCTGACTTCCTATTGGGGGCAGTAAAT
TTAAGGCAACTGATTCGCGCAGATCAAGCTCGATTAGATTTTTATCGTGGCGGAATGACTGCGAATCTCT
TTCAGGAATCGGATGATATTTTTGAGAAAACAATACGTGTCAACTTAGCAATGCTTGAGAACAACATAGA
TGCTGCAACATCGTTAGTTTTCGAAATCGAAAATGATCGAGAGAAAGTATTAGCAAGTGTCAATAACAAC
TCTATTGATGATATTAGAGATTTAGATGATGTTTTAGCGGGTTACGTTGAAATATATGGTACTGATGGAA
AATTTTACTTAGCGAAGTTTTCTGAAATTGAACATTTTACTGTACATAAGGCTGAATCAATTATTGATAG
TGTTTGGCGACGTATTGATATTTCAATTGAAAATGGACCCAGCGGCGAAGCATTTCTTCCATTAACGTAT
GTTTCAAGTGAGGATGAATCTTCTCGCTTAGGTAAAGATACTGATTGGTTGCAAAAAGGGGAGTTTGTTG
CCACAGGGACAGGTCTTAAAATGTGGTTGGTTGGTGATGAAGTACTACCAATTACAGCGATAAGTAGTTT
TGAAAAGATGGCATCTTGCTCAGCTTAA