SecReT6
Protein ID: 386324511
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2054
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2430560..2431048 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDG0AY96
KEGG IDsbb:Sbal175_2054
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.70E-22, Aligned region: 36..142
Protein Sequence: 162 a.a.     [Download]
>gi|386324511|ref|YP_006020628.1| type VI secretion system lysozyme-like protein [Shewanella baltica BA175]
MKINNKQSLQMSLIDRLIDDAPGQSDDLRSRRNFDLRALRSNVKRDLENLLNSRVQWHVWPDCYQELNQS
LLNYGLPDFSVMVVDTDHGREKLCRAVEQTIRRFEPRFIDVEVTLLENEEVIDRVLKLRIQALLYADPEP
EHIMFDSEIEPVHLGLTIKDYQ
 
Nucleotide Sequence: 489 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2430560-2431048 Shewanella baltica BA175 chromosome, complete genome
TTGAAAATTAATAATAAGCAATCTTTACAAATGTCACTTATTGATCGGTTGATCGATGACGCTCCCGGAC
AAAGTGATGATCTTCGTTCACGGCGTAACTTTGATTTACGCGCTTTGCGGTCAAATGTTAAGCGTGATCT
TGAAAATCTTCTCAACAGCCGAGTTCAGTGGCATGTTTGGCCTGATTGCTATCAAGAATTAAATCAAAGC
TTATTGAATTATGGTTTACCTGATTTTTCAGTGATGGTTGTTGATACCGATCATGGGCGTGAAAAGCTAT
GCCGAGCTGTTGAACAAACGATAAGGCGTTTTGAGCCGCGGTTTATTGATGTAGAAGTTACATTACTCGA
AAATGAAGAGGTTATAGACCGTGTGCTAAAGCTAAGAATCCAAGCGTTACTATATGCAGATCCTGAACCT
GAACATATTATGTTTGATTCAGAGATAGAGCCCGTTCACTTGGGATTAACGATAAAGGATTATCAATAA