SecReT6
Protein ID: 386324512
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2055
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2431048..2432877 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDG0AY97
KEGG IDsbb:Sbal175_2055
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.10E-189, Aligned region: 5..609
Protein Sequence: 609 a.a.     [Download]
>gi|386324512|ref|YP_006020629.1| type VI secretion protein [Shewanella baltica BA175]
MNDELLKYYNRELTFIRRMGAEFAEQYPKIAGRLRISEENVEDPHVSRLIEGFSLLTAQIRQKLDDSFPE
VTDALLGQLYPDYQAPIPACSILKLTSQNLSTSGVLVARGTEFETKTEGLKNCLFQSCYDTEVLPLEVTK
AEFKNAPFNAPTPNLKQPIKALVKLTLTCEFDTTEMHELGVTRLRFYLNGQRHHVYPLYELLHRQVISIG
VSASDEASIRYLQPRHIQQVGFGDNESVVPYSQKSFSGYRLLIEQFLCPEKFLFIDLIDLDPNWHGIKDE
FNLYFYLSEGAAELERHINADSFLLGCTPVINLFQQKLEPIKLVSSQYEYRLAASYLDADVCEIISIQDI
RAYDPFGNEMVLNPYYSQGHPAFSQQQNMFWHSRREFVNWAGGYSEAGTEVYLSIIDCQFKGMAIDGAEQ
DWVIQVNALCSNRNLPSYLPFGGGEPHFSIRSHVDIIKDVRCLIAPTSPVRPALKENTRWQLVNHLTLMS
FSGENALSQLQETLKLYDFRGAPESRSLIDGITAVTISNGTARVNQQGRVAVCAGSDILIEFSQSSYAGT
GVYFFAGILDIFFSQFAAINSYTRLSIKLRDQAQIYHTWPARVGTQVLL
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2431048-2432877 Shewanella baltica BA175 chromosome, complete genome
ATGAATGATGAACTCCTGAAGTATTATAATCGTGAGCTTACTTTCATACGTCGCATGGGCGCAGAGTTTG
CTGAGCAATATCCCAAAATTGCAGGGCGTTTACGTATATCGGAAGAGAATGTAGAAGATCCGCATGTCTC
ACGATTGATCGAAGGTTTTTCGTTACTCACTGCTCAAATTAGGCAGAAACTAGATGATAGTTTTCCTGAA
GTAACGGATGCATTATTGGGTCAGCTATATCCAGATTATCAAGCACCCATCCCGGCCTGCTCGATTCTTA
AATTGACGAGCCAGAATCTTTCTACTTCTGGAGTTCTAGTTGCTCGGGGAACAGAGTTTGAAACTAAAAC
TGAAGGGCTTAAAAACTGTTTATTTCAATCTTGCTATGATACGGAAGTGCTACCTCTAGAGGTAACAAAA
GCAGAGTTTAAAAACGCTCCGTTTAATGCTCCAACACCGAACTTAAAACAGCCTATTAAGGCGCTTGTTA
AACTTACACTTACTTGTGAATTTGATACGACGGAAATGCATGAGCTTGGTGTGACGCGTTTACGATTTTA
TTTGAATGGACAACGTCATCATGTGTATCCGCTCTATGAGCTTTTACATCGTCAAGTTATCAGTATTGGG
GTATCTGCTTCTGATGAAGCAAGTATTCGTTATTTACAACCTCGGCATATACAACAAGTAGGATTTGGTG
ACAATGAGAGTGTAGTGCCATATAGCCAAAAAAGTTTTTCAGGCTATAGATTGCTTATTGAACAGTTTTT
GTGTCCTGAGAAATTTCTATTTATAGATCTAATTGATTTAGATCCAAATTGGCATGGGATTAAAGATGAA
TTTAATCTATATTTTTATCTTTCCGAAGGCGCTGCTGAATTAGAGCGTCATATCAATGCCGATAGTTTTT
TGCTTGGCTGCACTCCTGTAATTAACTTATTTCAGCAGAAGCTAGAGCCTATCAAGTTAGTGTCTTCACA
ATATGAATATCGTCTTGCAGCAAGCTATTTAGATGCTGATGTGTGTGAAATTATATCAATACAAGATATT
CGGGCTTATGATCCTTTTGGGAATGAGATGGTTCTGAATCCTTACTATAGTCAAGGGCATCCCGCATTCT
CCCAACAGCAGAATATGTTTTGGCATAGTCGACGTGAATTTGTGAATTGGGCCGGTGGTTATTCAGAGGC
TGGAACTGAAGTTTATCTGTCAATCATTGACTGTCAGTTTAAAGGTATGGCTATTGATGGTGCAGAACAA
GACTGGGTCATTCAAGTTAATGCACTATGCAGCAATCGAAATTTGCCCTCCTATTTACCTTTTGGAGGTG
GGGAGCCTCATTTTAGTATTCGTAGTCATGTAGACATTATTAAAGATGTCCGTTGTTTAATTGCTCCGAC
CTCGCCAGTTAGGCCCGCATTGAAAGAGAACACCCGCTGGCAGCTTGTAAATCACCTTACACTCATGAGT
TTCAGTGGCGAAAATGCATTGTCTCAGTTACAAGAAACATTAAAGTTATATGATTTTAGGGGAGCGCCAG
AGTCCAGATCGTTGATCGATGGAATAACCGCAGTAACCATTAGCAATGGAACGGCAAGAGTTAACCAGCA
AGGAAGAGTCGCTGTTTGTGCAGGCTCAGATATTCTTATTGAGTTTAGCCAATCATCCTATGCAGGAACG
GGAGTGTATTTTTTTGCAGGTATTTTAGATATTTTCTTTTCGCAGTTTGCTGCAATAAATTCTTACACTC
GACTCTCAATTAAATTGCGTGATCAGGCTCAGATTTATCATACATGGCCGGCTAGAGTCGGTACTCAGGT
GTTGCTATGA