SecReT6
Protein ID: 386324513
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2056
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2432874..2433872 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDG0AY98
KEGG IDsbb:Sbal175_2056
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-73, Aligned region: 8..310
Protein Sequence: 332 a.a.     [Download]
>gi|386324513|ref|YP_006020630.1| type VI secretion protein [Shewanella baltica BA175]
MSIRDWKDSPESFDFYQAVYFLQKQLSSQELHWHSVGRDAFPEQELIRFKSVQHLGFPGQAISKVESKDY
DSADKQAFNIHVSFMGLTGPSGVMPQHYSELMLQRLKLKDRTMRDFFDIFNHRLISLYYRAWEKHQFACH
YGSQQFSQDPFSQVVLKLVGSASNLNSYYAGAFVAKNRGAQFLKQILTDFLGAEIEIKSLQGHWISLNAS
ECSYLASGVKPEGVNAELGKSMMLGQKVWDVSSIIDINIKATSEVLRKLLPSQSLNLLVQKLVKEYLAPQ
VKARVTLVGRYIDFPAVRLGAGSNQLGQVGRLSIRNHKLEEVNRVGFKLARS
 
Nucleotide Sequence: 999 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2432874-2433872 Shewanella baltica BA175 chromosome, complete genome
ATGAGTATTAGGGATTGGAAAGACTCTCCAGAGAGTTTTGACTTTTATCAAGCAGTATACTTCTTGCAAA
AGCAGTTATCATCTCAAGAGCTCCATTGGCATAGTGTCGGGCGAGATGCTTTTCCTGAACAGGAGTTAAT
TAGATTTAAATCTGTTCAGCATTTAGGTTTTCCAGGGCAAGCAATCAGTAAAGTGGAAAGCAAAGACTAT
GATTCCGCAGATAAGCAAGCATTTAATATTCATGTAAGCTTTATGGGGTTGACTGGCCCTTCAGGTGTTA
TGCCCCAACATTATTCAGAATTAATGTTACAAAGGTTGAAATTAAAAGATCGTACAATGCGAGATTTTTT
CGATATTTTTAATCATAGACTTATATCACTGTATTATAGAGCTTGGGAAAAACATCAGTTTGCTTGTCAC
TATGGCAGTCAACAGTTTTCACAAGACCCATTTAGTCAGGTAGTGTTGAAACTCGTAGGTTCTGCTTCAA
ATTTAAACTCTTATTATGCAGGTGCATTTGTTGCTAAAAATAGAGGTGCCCAATTTTTAAAGCAAATACT
GACAGATTTCCTTGGCGCAGAGATTGAAATAAAATCATTGCAGGGGCATTGGATTTCGTTAAATGCATCA
GAATGTAGCTATCTAGCATCTGGAGTAAAACCTGAAGGTGTCAATGCTGAGCTAGGGAAGAGCATGATGT
TAGGACAGAAAGTATGGGATGTCAGCTCCATTATTGACATTAATATTAAGGCTACGTCTGAAGTTTTAAG
AAAATTACTACCCAGTCAATCTCTTAATTTATTAGTGCAAAAACTAGTTAAGGAATATTTAGCGCCTCAA
GTTAAAGCTAGGGTAACTTTAGTCGGCCGCTATATTGATTTCCCTGCTGTTCGGTTGGGTGCGGGAAGTA
ATCAGTTGGGACAGGTTGGAAGATTAAGTATTCGAAATCATAAGTTGGAAGAAGTTAACAGAGTTGGTTT
TAAATTAGCGCGTAGTTAA