SecReT6
Protein ID: 386324514
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2057
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2433892..2436504 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDG0AY99
KEGG IDsbb:Sbal175_2057
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.90E-41, Aligned region: 225..301
AAA_2 [PF07724], Evalue: 3.90E-41, Aligned region: 603..770
AAA [PF00004], Evalue: 4.30E-22, Aligned region: 225..356
AAA [PF00004], Evalue: 4.30E-22, Aligned region: 608..725
ClpB_D2-small [PF10431], Evalue: 3.30E-17, Aligned region: 775..847
AAA_16 [PF13191], Evalue: 1.70E-13, Aligned region: 202..244
AAA_16 [PF13191], Evalue: 1.70E-13, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 1.70E-13, Aligned region: 487..503
AAA_16 [PF13191], Evalue: 1.70E-13, Aligned region: 576..631
AAA_16 [PF13191], Evalue: 1.70E-13, Aligned region: 672..700
AAA_5 [PF07728], Evalue: 3.50E-11, Aligned region: 225..244
AAA_5 [PF07728], Evalue: 3.50E-11, Aligned region: 299..355
AAA_5 [PF07728], Evalue: 3.50E-11, Aligned region: 607..726
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 224..311
AAA_22 [PF13401], Evalue: 1.10E-08, Aligned region: 604..629
AAA_19 [PF13245], Evalue: 3.50E-08, Aligned region: 225..246
AAA_19 [PF13245], Evalue: 3.50E-08, Aligned region: 600..632
AAA_19 [PF13245], Evalue: 3.50E-08, Aligned region: 717..731
Clp_N [PF02861], Evalue: 3.80E-08, Aligned region: 28..75
Clp_N [PF02861], Evalue: 3.80E-08, Aligned region: 107..133
Sigma54_activat [PF00158], Evalue: 2.50E-07, Aligned region: 209..243
Sigma54_activat [PF00158], Evalue: 2.50E-07, Aligned region: 596..724
AAA_14 [PF13173], Evalue: 1.20E-06, Aligned region: 225..356
AAA_14 [PF13173], Evalue: 1.20E-06, Aligned region: 604..697
IstB_IS21 [PF01695], Evalue: 4.30E-06, Aligned region: 219..284
IstB_IS21 [PF01695], Evalue: 4.30E-06, Aligned region: 607..641
IstB_IS21 [PF01695], Evalue: 4.30E-06, Aligned region: 718..739
Arch_ATPase [PF01637], Evalue: 9.50E-06, Aligned region: 203..238
Arch_ATPase [PF01637], Evalue: 9.50E-06, Aligned region: 277..310
Arch_ATPase [PF01637], Evalue: 9.50E-06, Aligned region: 600..645
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 225..301
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 436..484
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 603..628
AAA_25 [PF13481], Evalue: 1.50E-05, Aligned region: 670..691
AAA_17 [PF13207], Evalue: 0.0001, Aligned region: 225..288
AAA_17 [PF13207], Evalue: 0.0001, Aligned region: 607..642
NACHT [PF05729], Evalue: 0.00013, Aligned region: 225..253
NACHT [PF05729], Evalue: 0.00013, Aligned region: 456..503
NACHT [PF05729], Evalue: 0.00013, Aligned region: 608..625
NACHT [PF05729], Evalue: 0.00013, Aligned region: 815..843
DUF2075 [PF09848], Evalue: 0.00019, Aligned region: 13..84
DUF2075 [PF09848], Evalue: 0.00019, Aligned region: 225..327
DUF2075 [PF09848], Evalue: 0.00019, Aligned region: 434..514
DUF2075 [PF09848], Evalue: 0.00019, Aligned region: 606..636
Zeta_toxin [PF06414], Evalue: 0.0003, Aligned region: 220..246
Zeta_toxin [PF06414], Evalue: 0.0003, Aligned region: 601..647
AAA_29 [PF13555], Evalue: 0.00043, Aligned region: 219..241
AAA_29 [PF13555], Evalue: 0.00043, Aligned region: 603..618
AAA_18 [PF13238], Evalue: 0.00059, Aligned region: 225..251
AAA_18 [PF13238], Evalue: 0.00059, Aligned region: 608..632
NTPase_1 [PF03266], Evalue: 0.00084, Aligned region: 225..245
NTPase_1 [PF03266], Evalue: 0.00084, Aligned region: 276..302
NTPase_1 [PF03266], Evalue: 0.00084, Aligned region: 607..631
DUF815 [PF05673], Evalue: 0.002, Aligned region: 216..301
DUF815 [PF05673], Evalue: 0.002, Aligned region: 587..640
AAA_30 [PF13604], Evalue: 0.002, Aligned region: 223..302
AAA_30 [PF13604], Evalue: 0.002, Aligned region: 603..632
T2SE [PF00437], Evalue: 0.0026, Aligned region: 203..246
T2SE [PF00437], Evalue: 0.0026, Aligned region: 602..651
DAP3 [PF10236], Evalue: 0.0029, Aligned region: 216..237
DAP3 [PF10236], Evalue: 0.0029, Aligned region: 266..306
DAP3 [PF10236], Evalue: 0.0029, Aligned region: 478..508
DAP3 [PF10236], Evalue: 0.0029, Aligned region: 580..625
EzrA [PF06160], Evalue: 0.0044, Aligned region: 57..84
EzrA [PF06160], Evalue: 0.0044, Aligned region: 419..498
PhoH [PF02562], Evalue: 0.0048, Aligned region: 208..244
PhoH [PF02562], Evalue: 0.0048, Aligned region: 597..638
TIP49 [PF06068], Evalue: 0.0077, Aligned region: 225..246
TIP49 [PF06068], Evalue: 0.0077, Aligned region: 282..305
TIP49 [PF06068], Evalue: 0.0077, Aligned region: 574..643
DUF258 [PF03193], Evalue: 0.0087, Aligned region: 217..244
DUF258 [PF03193], Evalue: 0.0087, Aligned region: 594..618
Protein Sequence: 870 a.a.     [Download]
>gi|386324514|ref|YP_006020631.1| type VI secretion ATPase, ClpV1 family [Shewanella baltica BA175]
MSNTPLKSLVEKLSPSSKMALEAATAKCQSRSHYSVEIEHWLDAILEQKDSDIRLLLNAFSIDVDRVKYQ
LQQALENFKTGNNSLPAISVQVVNLLKATWLNTSIDFNDERIRTAYLLYSLLKDETLLAPISRRVTELDK
IDAAEILRVWPSLAQHSHEQQAANISSNNTSDAPTTAGKTPSLDQFTVDLTKQARAGKIDPIIGRDFEIR
QMIDILSRRRQNNPILTGEAGVGKTAVVEGLALKIAAGDVPDRLKNVSLRVLDLALLQAGAGMKGEFENR
LKNVIKEVRQSAQPIILFIDEAHTMIGSGGQAGQNDAANLLKPALARGELRTIAATTWAEYKKYFEKDAA
LTRRFQVVKVEEPKPELAIVMLRGILPVMETHHGVNIADKALQAAVHLSDRYINGRQLPDKAVGLLDTAC
SRVSMSQDAIPGQLEDQQRRVQQLEAEIALLQRELRLGADHLVAIDLLTNQILDANNKLEQVQQQWTYEK
SLVSEAKELATLLHTENGEDNSASLHRLNEIKALLSAIPNPMVHWQVTENLVAEVVSDWTGIPLGKMQAD
EIKTILALKSILEERVVGQEHALELIARTVQTSRAQLADENKPNGIFLLTGPSGVGKTETALAVAEQVYG
SEDSITIINMSEFKEEHKVSLLLGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVF
DKGTIKDGEGRDIDFKNTIIIITSNVGTDTTMRLFEDESTSPSPNGLAKALKPDLLQVFKPAFLGRINVI
PYLPLADEQLKQIICLQLKRVTRRLLNNYKVEFNYDEDVVNYIVSQCQDADSGARTIHNVIQNRILPEMS
VKILQFVAESKALSNIRLMVDGNEFKYDIL
 
Nucleotide Sequence: 2613 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2433892-2436504 Shewanella baltica BA175 chromosome, complete genome
ATGTCAAATACCCCATTAAAGAGCCTTGTTGAAAAGCTTAGTCCATCATCAAAAATGGCACTTGAGGCTG
CAACGGCTAAATGTCAGTCTCGTAGTCACTATAGCGTTGAAATTGAGCACTGGCTGGATGCAATTTTAGA
ACAGAAGGATTCAGATATTAGGCTTCTGTTGAATGCATTCTCTATTGATGTTGATAGGGTGAAGTATCAA
TTACAACAAGCATTAGAAAACTTTAAGACAGGTAACAATTCTTTACCTGCTATTTCCGTGCAAGTTGTTA
ACTTGTTAAAAGCAACATGGTTGAATACAAGTATTGATTTTAATGATGAGCGTATTCGGACGGCATATTT
ACTCTATTCATTGTTGAAGGATGAAACTTTACTCGCCCCTATTAGTAGGCGTGTTACTGAGCTCGACAAA
ATTGATGCTGCTGAAATACTAAGAGTCTGGCCAAGTCTGGCTCAGCATTCACATGAACAACAAGCTGCAA
ATATAAGTTCAAATAATACTTCTGATGCACCGACTACAGCAGGTAAAACACCGTCATTAGATCAGTTTAC
TGTTGATTTAACAAAACAAGCTAGGGCTGGAAAAATTGATCCCATAATTGGACGTGATTTCGAGATTCGA
CAGATGATCGATATTTTATCCCGTCGTCGTCAAAATAATCCCATTTTAACGGGTGAGGCGGGTGTTGGGA
AAACCGCTGTTGTCGAGGGCTTAGCTCTTAAAATAGCTGCAGGCGATGTTCCTGATCGTCTAAAGAATGT
TTCTCTGCGTGTCCTTGATCTTGCGCTATTACAGGCGGGTGCAGGCATGAAAGGGGAGTTTGAAAACCGC
TTGAAAAATGTGATCAAGGAAGTTCGCCAGAGTGCTCAACCTATAATATTGTTTATCGATGAAGCGCATA
CAATGATAGGTAGTGGTGGTCAAGCTGGGCAGAATGACGCGGCTAATTTATTAAAACCTGCATTAGCTCG
TGGTGAATTGCGGACTATTGCCGCGACAACTTGGGCTGAATATAAAAAATATTTTGAAAAAGATGCGGCG
CTAACCCGTCGTTTCCAAGTTGTAAAAGTCGAAGAGCCAAAGCCTGAACTCGCAATTGTTATGTTGCGAG
GAATCTTGCCTGTTATGGAAACGCATCATGGTGTCAATATTGCGGATAAAGCACTGCAAGCAGCGGTACA
TTTATCCGACCGTTATATTAATGGTCGACAGTTACCGGATAAGGCTGTTGGCTTACTTGATACCGCATGT
TCGCGAGTGTCAATGAGTCAAGATGCTATTCCTGGTCAGCTTGAAGATCAGCAGCGCCGTGTACAGCAGC
TTGAAGCCGAAATAGCACTATTACAACGCGAACTAAGATTAGGTGCGGACCACTTAGTTGCTATTGATTT
GCTTACTAATCAAATTCTCGATGCAAATAATAAGCTTGAACAAGTTCAGCAGCAGTGGACATATGAAAAA
AGTTTAGTTTCAGAAGCAAAAGAACTCGCGACATTACTGCATACGGAGAATGGGGAGGATAATAGTGCAT
CACTTCATCGACTGAATGAAATAAAGGCATTATTGTCAGCCATTCCAAATCCAATGGTTCATTGGCAGGT
TACAGAAAACTTAGTTGCAGAGGTTGTCTCTGATTGGACTGGTATTCCTTTAGGGAAAATGCAAGCTGAT
GAAATAAAAACAATTCTGGCATTAAAGTCAATTCTAGAAGAGAGGGTTGTTGGTCAAGAACACGCCTTAG
AGTTAATTGCCCGTACGGTACAAACATCACGCGCACAACTTGCTGACGAAAATAAACCGAATGGTATCTT
TTTACTCACAGGTCCAAGTGGTGTAGGTAAAACTGAAACCGCTCTTGCTGTTGCAGAGCAAGTATATGGT
AGTGAAGATAGTATCACTATTATCAATATGTCGGAGTTTAAGGAGGAACATAAAGTATCCTTATTACTCG
GTTCTCCACCAGGCTATGTAGGATACGGTGAAGGTGGTGTGTTAACCGAAGCTGTGCGCCGCAAGCCTTA
TAGCGTAATTCTACTCGATGAAATGGAAAAGGCTCATCCCGGTGTTCAAGATATTTTTTATCAGGTTTTT
GATAAAGGAACAATAAAGGACGGAGAAGGTAGAGATATTGATTTTAAGAATACAATAATCATTATAACTT
CAAATGTCGGTACTGACACGACTATGCGTTTATTTGAGGATGAATCAACATCTCCCTCGCCAAATGGACT
TGCTAAAGCACTTAAACCTGATCTTCTACAAGTCTTTAAGCCTGCATTTTTAGGTCGGATAAATGTTATT
CCCTATTTGCCATTGGCAGATGAACAACTTAAACAGATTATTTGTTTGCAACTCAAGCGTGTTACTCGAA
GGTTGTTGAATAATTATAAAGTCGAATTTAATTATGATGAAGATGTTGTCAATTATATTGTCTCGCAGTG
TCAAGATGCTGATAGTGGTGCAAGAACCATACATAACGTTATTCAGAATAGAATATTGCCAGAGATGTCA
GTCAAGATTTTACAATTTGTTGCAGAGAGCAAAGCTCTATCAAATATCAGACTAATGGTTGATGGCAATG
AATTCAAATATGATATTTTATAA