SecReT6
Protein ID: 386600808
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3194
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3256273..3257811 [+]
Producthypothetical protein
NoteTssC
UniProt IDD5CZ92
KEGG IDeih:ECOK1_3194
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.20E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|386600808|ref|YP_006102314.1| hypothetical protein ECOK1_3194 [Escherichia coli IHE3034]
MSVQQEHSTSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLLSC
LAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDI
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3256273-3257811 Escherichia coli IHE3034 chromosome, complete genome
ATGTCTGTACAACAAGAACATTCCACCTCTGAAACTGCAACACTCACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTCGATAAAATTAATTTAACCCCGGTCTCTTCCATTCAGGAAATAGATTTATGGCAAAA
CAGCGAAACGCTGGCTGATGCCTCACCCGATGAGCGCGTGACAGCAGCGATTCACGTTCTGCTTTCCTGT
CTGGCGAAATCAGGCGAGGACGTGGTTAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACGATCTGG
ATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCACCCTGAATTCCAGAAAGTCGAGTCGCTGTG
GCGTGGTACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTGGATATC
AGCAAAGAGCATCTGCGTCAGGATTTCGACGACTCCCCGGAAATCATTCAGAGCGGTTTATATCGTCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTTGCCTCATTAATTTCCAGCTATGAATTTGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGCAATATTTCCAGAGTGTCTGCCGCTTCCCATATGCCTTTT
ATCGGTTCCGTCGGACCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAGATATCG
GCAACTACTTTGACCGCGCAGAATATATTAAATGGAAGTCGTTCCGCGATACGGATGACAGCCGCTATGT
GGGATTAGTGATGCCGCGAGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAGTACCTGTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGTGTGCAGATCCGTGGTCCACAGGCAGGTGG
CGCAGTAGCCGATCTGCCCATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCGGCAAACTCCGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACCGCCAACAGCCGTATTAACGCCCGTCTGCCTTACATCTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATCATTCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAACTGAACACCT
GGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGCAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATTGAAGGGATGGATATCAACCTTTCTCTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA