SecReT6
Protein ID: 386600809
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3195
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3257829..3259166 [+]
Producthypothetical protein
NoteTssK
UniProt IDD5CZ93
KEGG IDeih:ECOK1_3195
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-131, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|386600809|ref|YP_006102315.1| hypothetical protein ECOK1_3195 [Escherichia coli IHE3034]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDCIAQLCIRHPWGIANVLFDRDALTPGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLRALKNDSAIVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALDLASLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVQLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGSCMIYAPGTMGDLKPELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3257829-3259166 Escherichia coli IHE3034 chromosome, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACTGTATTGCGCAGCTTTGTATTCGCCATCCGTGGGGGATCGCAAACGT
GCTCTTTGACCGGGATGCCCTGACGCCCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCAGACGTGAGTGACGTTCTGCCGCTCGCCTGCGATCTGCGCGCGCTGAAGAACG
ACAGCGCGATTGTTTTGCTGGCGCTGCCGCTTGCACATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTGCGCTATCGTCAGGAATGGCAAAAGGTGCAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGCTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGGCTGGTACAGCGTCTGGACACATTGCTGTTGCAGCTACGGGCGAAG
TGCCAGCGTCTGATGGCGATGCGCCGGGAAAGCAACCAGCGTATGGCGGACTTTGCCGTCGCCGATGTCT
CCCTGTTCTGGCTGCTTAACGCGCTGAATTCCGCCGAGCCGGTGCTGAGCGATTTCCTGCGCTACCCGGC
TGTCCACCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGTGCGCTGCTGACGTTTTCCCTTGAG
CATAACGTCAGCGCCGTTCCGCCCTATGTCCACGAATCGCCGTCCACCGTCTTTCCGCCCCTGTTCTCCC
TGCTCAGCGAGCTGCTGGAAGCCAGCCTGCCGTCGCGGGTGATCGCGCTGGATCTGGCGTCCCTGCCGGG
CAACCGCTGGAAAGCCGACCTGCACGATCCGCGACTGCGGGAAGAGGCCGATTTTTATCTGTCCGTTCGT
TCCTCACTGCCTGCGCATCAGGTACTGCATCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCCGATGATG
TCACGCTGCTTATCAACGTGGCGCTGAACGGTGTTCAACTGGTGCCGCTTACCTCGGTTCCGGCGGCGCT
GCCGCTGCGGCTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGAGCTGCATGATTTATGCGCCGGGAACCATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCACATGA