SecReT6
Protein ID: 386600810
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3196
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3259163..3259828 [+]
Producttype IV/VI secretion system protein, DotU family
NoteTssL
UniProt IDD5CZ94
KEGG IDeih:ECOK1_3196
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-49, Aligned region: 8..208
Protein Sequence: 221 a.a.     [Download]
>gi|386600810|ref|YP_006102316.1| type IV/VI secretion system protein, DotU family [Escherichia coli IHE3034]
MKKDMDINIDALLRDTFLTVVELRQGTTVRHGIELYRHCQRQVELVRERLKDAGFSRENVEHITYAQCAL
LDETVLSRSGMDDGQAIWMKNPLQSHFFNTLQAGELLYERMKQVLQEPAPAQAVLTCFHRVLLLGFRGRY
QDPAAPERDQLISTLNGQVAPFGVLPETAVLNVPLSTRQHPLLHSPFFWLVTLALLLAGVWWGLHHWLNV
LVDELLPQSLR
 
Nucleotide Sequence: 666 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3259163-3259828 Escherichia coli IHE3034 chromosome, complete genome
ATGAAAAAAGATATGGATATCAATATCGATGCGCTGCTGCGCGACACGTTTCTGACGGTGGTGGAACTGC
GTCAGGGAACCACCGTGCGTCACGGTATCGAGCTGTATCGCCACTGTCAGCGGCAGGTGGAACTGGTCCG
CGAACGTCTGAAAGATGCCGGATTCAGTCGGGAGAACGTGGAGCACATAACTTACGCGCAGTGCGCCCTG
CTGGACGAAACGGTGCTCAGCCGTAGTGGCATGGACGACGGTCAGGCCATCTGGATGAAAAACCCACTCC
AGTCGCATTTCTTCAACACCCTGCAGGCCGGTGAGCTGCTGTACGAGCGGATGAAGCAGGTGCTACAGGA
ACCCGCCCCCGCGCAGGCCGTGCTGACCTGCTTTCACCGTGTCCTGCTGCTGGGATTTCGCGGGCGTTAT
CAGGATCCGGCAGCCCCGGAGCGCGACCAGCTTATTTCGACGCTCAACGGGCAGGTCGCGCCATTTGGTG
TGCTGCCGGAAACGGCGGTACTGAACGTGCCGTTATCCACCCGTCAGCACCCTTTGCTGCATTCGCCATT
TTTCTGGCTGGTAACACTGGCGCTGCTACTGGCGGGCGTCTGGTGGGGGCTACACCACTGGCTGAATGTA
CTGGTGGATGAACTGCTGCCGCAAAGCCTGCGTTAA