SecReT6
Protein ID: 386600811
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3197
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3259841..3261493 [+]
ProductOmpA domain-containing protein
NoteTagL
UniProt IDD5CZ95, D5CZ95
KEGG IDeih:ECOK1_3197
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.30E-17, Aligned region: 437..533
Protein Sequence: 550 a.a.     [Download]
>gi|386600811|ref|YP_006102317.1| OmpA domain-containing protein [Escherichia coli IHE3034]
MRNTLKQAIVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTGDAGLSSLPPE
TYRQPVVLVCGGLSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTLRPAWASQLAVAYTIMPGIHR
DVAVLAGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPERASSPWFICTGGEVQVATSTENAMPAQW
IAQSGVQERSQRLSYLLKAESLMQWLDLNVLAELNGPEAKCPPLAMAVGLVPSLPAVDNNLWQLWITART
GLTPDIADTGTDDALPFPDALLRRLPRQSGFTPLRRACVTMLGVTTVAGIAALCLSATANRQLLRQVGDD
LHRFYAVPVEEFITKARHLSVLKDDATMLDGYYREGEPLRLGLGLYPGERIRQPVLRAIRDWRPPEQKME
VTASLQVQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3259841-3261493 Escherichia coli IHE3034 chromosome, complete genome
GTGAGGAACACGCTGAAACAGGCCATCGTGCTGTGGGGAATGGTGTTACTGCTGGTGCTGTGGTCAGTGT
TTATCAGTCCGTCTGGCGTGCTGAGATGGGCCGGTGCGGCGGCTATCGTTCTGGCGGTTGCTGCGTTGTT
GATTTATCGGCGCAGGCAGGCGTGGACGGAGATGACCGGCGATGCCGGGTTGTCATCGCTGCCGCCGGAA
ACCTACCGACAGCCGGTAGTGCTGGTCTGTGGCGGTCTGTCGGCGCACCTGTTCACTGACAGCCCGGTCC
GCCAGGTTTCAGAAGGGCTGTATCTGCATGTTCCTGATGAAGAACAGCTTGTGGCGCAGGTGGAGCGATT
GCTGACCCTTCGCCCGGCGTGGGCATCGCAGCTTGCCGTGGCGTATACCATCATGCCCGGCATACACCGG
GATGTGGCGGTTCTGGCCGGACGGCTGCGACGGTTCGCCCACAGTATGGCGACGGTGCGTCGTCGGGCAG
GCGTAAACGTCCCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCGTTGCCGGAAAGAGCGAGTTCACC
GTGGTTTATCTGTACCGGCGGCGAAGTTCAGGTAGCAACATCCACAGAGAACGCGATGCCCGCGCAGTGG
ATTGCACAATCCGGCGTACAGGAACGCAGTCAGCGACTCTCTTATCTGCTGAAAGCCGAAAGCCTGATGC
AGTGGCTGGATCTTAATGTGCTGGCGGAACTGAACGGCCCGGAGGCGAAATGTCCACCACTGGCGATGGC
CGTGGGGCTGGTCCCCTCGTTGCCTGCGGTGGATAACAACCTGTGGCAGTTGTGGATCACCGCCAGAACC
GGCCTGACGCCGGATATCGCGGACACCGGCACAGACGATGCGCTGCCATTCCCGGATGCCCTGTTACGGC
GGTTGCCGCGTCAGTCGGGCTTTACCCCGCTGCGACGGGCCTGCGTGACCATGCTGGGCGTCACCACCGT
GGCGGGTATCGCCGCGCTGTGCCTGTCAGCCACGGCAAATCGCCAGTTATTACGGCAGGTCGGTGACGAT
CTGCACCGGTTTTATGCCGTCCCGGTGGAGGAATTTATCACCAAAGCCCGTCACCTGTCGGTGCTGAAAG
ACGATGCGACCATGCTCGATGGGTATTACCGGGAAGGAGAACCACTGCGCCTCGGTCTGGGGTTATACCC
CGGCGAACGCATCCGCCAGCCGGTATTACGCGCCATTCGCGACTGGCGTCCGCCTGAACAAAAAATGGAG
GTGACGGCTTCGCTTCAGGTTCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCCC
GCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGACGCACTGGTGAACATCCGGGCAAAACCGGGCTGGCT
GATCCTCGTGGCCGGATATACCGATGCCACCGGCGATGAAAAAAGCAATCAGCAGTTATCGCTGCGGCGT
GCCGAAGCGGTGCGCAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGAC
TGGGCGAGAGCCAGCCTGCGGCGACCAACGACACGCCACAGGGCCGGGCAGTCAACCGGCGTGTCGAAAT
CAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATAA