SecReT6
Protein ID: 386600812
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3198
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3261551..3262042 [+]
Producthypothetical protein
NoteTssD
UniProt IDD5CZ96
KEGG IDeih:ECOK1_3198
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.10E-39, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|386600812|ref|YP_006102318.1| hypothetical protein ECOK1_3198 [Escherichia coli IHE3034]
MAIPAYLWLKDDGGADIKGSVDVQGREGSIEVVALDHDVYIPTDNNTGKLTGTRTHKPFTFTKEIDASSP
YLYKAVTTGQTLKTAEFKFYRINDAGQEVEYFNTTLDNVKLVRVAPLMHDIKDPGKEKHNHLERIEFRYE
KITWTYKDGNIIHSDSWNERPSA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3261551-3262042 Escherichia coli IHE3034 chromosome, complete genome
ATGGCTATTCCTGCTTATCTCTGGCTGAAAGATGACGGCGGCGCGGATATCAAAGGTTCCGTGGACGTTC
AGGGGCGCGAAGGTAGCATCGAAGTGGTGGCGCTGGATCACGATGTGTACATCCCGACCGACAATAACAC
CGGCAAACTGACCGGTACCCGTACTCACAAGCCTTTTACGTTTACCAAAGAAATCGATGCCTCCAGCCCG
TATCTCTACAAAGCTGTGACCACCGGACAGACCCTGAAAACGGCGGAGTTTAAATTCTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTATTTCAATACCACGCTGGATAACGTCAAGCTGGTCAGAGTAGCTCCGCT
GATGCACGACATCAAAGATCCGGGTAAAGAGAAGCATAACCACCTGGAACGCATTGAGTTCCGCTACGAG
AAAATCACCTGGACTTACAAAGACGGCAACATCATTCATTCCGACTCGTGGAATGAGCGTCCTTCCGCCT
GA