SecReT6
Protein ID: 386600815
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3201
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3267391..3269160 [+]
Producthypothetical protein
NoteTle4 (e)
UniProt IDD5CZ99
KEGG IDeih:ECOK1_3201
PDB IDNA
Domain hit(s) vs Pfam PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 25..37
PGAP1 [PF07819], Evalue: 2.30E-07, Aligned region: 227..263
LCAT [PF02450], Evalue: 8.10E-05, Aligned region: 245..296
LCAT [PF02450], Evalue: 8.10E-05, Aligned region: 381..424
LCAT [PF02450], Evalue: 8.10E-05, Aligned region: 526..565
Abhydrolase_6 [PF12697], Evalue: 0.0028, Aligned region: 240..272
Protein Sequence: 589 a.a.     [Download]
>gi|386600815|ref|YP_006102321.1| hypothetical protein ECOK1_3201 [Escherichia coli IHE3034]
MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWSLPTSGPKERK
RLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAVRDILDNIEPEAKLFGSRKDR
GWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQLLDVPLGLEYGPDSLDEEYLEVIRLYQFPVH
VVGYNWLGSNMLSAIRLQEQIKKIVGGYQKRGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGV
LPSIGAAATYTRMKRGTENPESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYGEEWLNIVDRD
GSTLTLPKNLPIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSLNQKQIDTDWNIYENLITESVN
PFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMGKKSDISLEPKFIDGRLDLNEVGNIR
TIKDEFSPEEQAWEINTDDGDTYVKIGQRFTLRDSCENGDGTVPLRAGQIVHKNILERLAVQVSHEAAYR
NPVSQAFALRSIIKIAQEVKKDGKMSYSD
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3267391-3269160 Escherichia coli IHE3034 chromosome, complete genome
ATGACATCGACGATGCATATGGACAGGGCCGATAAGAATAAAGTTGGCACCGTTGAAATTGAGGATCTAC
GGGTTATTCCGGTTATTTTTCTGCCCGGAGTCATGGGTTCAAACCTTATGGATAAGAAAGGAAAATCCAT
CTGGCGATATGATGACTCTATGAGTCTGATGGGCTGGTCACTACCTACATCAGGACCAAAAGAGAGGAAA
AGATTATTGCATCCTGACAGGGTGGAGGTCGATAATCGTGGGAGAATTCCCGCACCTCCGGATGCCCAAG
AAAAACTTATTCAGTTAGGTCAACAATATCCGGAGGACCCATCCGATAAAGAAGCAATGGATAATTACAC
TCAGGCAGTACGTGACATTTTGGATAATATAGAGCCAGAAGCGAAATTATTTGGTTCAAGAAAAGATCGC
GGCTGGGGAGAGGTTGCAAATGCTAGCTACGGTTCCTTTCTCGATGTATTACAAACAGCATTGTACCGGG
ACAAACCTACAAAGAAAGGTGAGACGTTAAGTGCGACCTACCAGCAACTACTCGATGTACCTTTGGGTTT
GGAGTATGGTCCTGACTCACTTGATGAAGAGTATCTTGAAGTCATAAGGTTGTATCAATTTCCGGTCCAT
GTCGTTGGCTATAACTGGCTTGGTTCTAATATGCTCTCAGCAATCAGACTACAAGAACAGATCAAGAAAA
TTGTTGGAGGCTATCAAAAACGAGGAATGAAATGCCATAAAGTTATTCTGGTTACGCATTCAATGGGAGG
ACTAGTGGCAAGGTACTTTTCAGAGTGTCTTTCGGGGAATACGGATGTCTACGGTATTGTTCATGGCGTA
TTACCATCAATTGGTGCTGCGGCGACATATACCCGAATGAAACGTGGAACTGAAAACCCAGAGTCAAATC
CGGAAGGGTATGTTATCAGTCATATCTTAGGTCGTAATGCAGCTGAAATGGTAGCTGTTTTTTCCCAGTC
GCCAGGACCAATGGAATTACTACCCATGAATGATTATGGTGAAGAGTGGCTTAATATTGTCGATCGTGAT
GGTAGTACATTAACGCTCCCTAAAAATCTTCCCATTAAAGAAGGTATTGCCCCCGAAGAACGCACCTACG
CTGAACTTTATCTAAATAGAGAAAATTGGTGGAAATTGGTGGATGAGAATCTATTGAATCCTTTTAATAC
TTCATTAAATCAAAAGCAAATTGATACTGATTGGAATATATATGAAAATTTAATTACTGAGAGTGTCAAT
CCATTTCATAAGCAAATTGCTGGAAAATATCATATCAATACTTACTCTTTCTATGGGAGAGCGAAATTGG
GAGATATTCCTGAAGCGCATTTAACGCAGGAAAATGTTCTTTGGAAAGGCTCATTATCAATGGGAAAAAA
AAGTGATATATCTTTAGAACCAAAATTCATTGATGGTCGTCTTGATTTAAATGAAGTTGGTAACATTAGA
ACTATTAAGGATGAATTTTCTCCTGAAGAACAGGCGTGGGAAATAAATACTGACGACGGTGATACATATG
TTAAGATAGGACAGCGTTTTACATTACGAGACTCTTGTGAAAACGGGGATGGTACAGTACCTCTTCGTGC
AGGACAAATCGTACACAAGAACATCCTAGAGCGTTTGGCTGTACAGGTTTCTCACGAGGCTGCTTATCGA
AATCCCGTTAGTCAGGCATTTGCATTACGTTCTATTATAAAAATAGCTCAGGAGGTAAAAAAGGATGGTA
AAATGTCATACTCTGATTAA