SecReT6
Protein ID: 386600818
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3205
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3275433..3277058 [+]
ProductImpA-like protein
NoteTssA
UniProt IDD5CZA2
KEGG IDeih:ECOK1_3205
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 4.80E-20, Aligned region: 72..131
Protein Sequence: 541 a.a.     [Download]
>gi|386600818|ref|YP_006102324.1| ImpA-like protein [Escherichia coli IHE3034]
MGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLLPVTADTPVGEDPGYHDDFLRIRDEMNKLSGT
DTGLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLTGLVERFGTQLLPSRPASRKMALE
WLAGEKMLDSLARYPEVAKEDFANIVAALNQLTVSFTAWPEDQHSPSLMPLINALESRLAQSGGMNAVVP
QNSSSVTAPSSPVDAPQVQTITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGK
TRLAPPRTESRNQLKRLYAQQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGVPWDRWTAVIRQD
LALLLERLPGLENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALAMA
DSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITLTQWEPELLFE
VKARQLKLLRLRAHRYADKALLNRKMEILLGTLVAIDPARAAVLCDTQHKD
 
Nucleotide Sequence: 1626 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3275433-3277058 Escherichia coli IHE3034 chromosome, complete genome
ATGGGGAAGACGCCGATGAGTGAACTGTTGCAAAAGCTGACCCGTAGCTGTTTTGCCGACCGGGATGCAC
TGGATGTGGCGCGAACACAGGCGGCGCTGTGGCAGACATGGCTGCTGCCGGTGACGGCAGACACGCCGGT
CGGGGAAGACCCCGGCTACCACGACGATTTCCTGCGTATACGCGACGAAATGAACAAACTTTCCGGCACA
GATACCGGCCTTATCTGCCAGCTTGCCGAATCCCTGCTGCTGACGCAGGCCAAAGACGTGCGCATCGCCA
CTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCGGAAGGACTGGCGCTGCTGAC
CGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGTCCGGCCAGCCGGAAAATGGCGCTGGAG
TGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAAGAGGATTTTGCGA
ACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCACTGCATGGCCCGAAGACCAGCATTCCCCCTC
CCTGATGCCACTGATTAACGCGCTGGAATCACGTCTGGCGCAGTCGGGCGGGATGAACGCGGTGGTGCCG
CAAAACAGCAGCAGCGTTACTGCACCGTCATCCCCGGTGGATGCGCCACAGGTACAGACCATCACCTCCG
GGCGTGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGCAGGGCTGGCTTTC
GGCGCACCGGCTGATGAAAACCCTGCGCTGGGACACGGTGCATGAACTGCCGCCGGATGTGGACGGCAAA
ACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCCCAGCAGAACTGGA
CGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGCCATTTCTGGCTGGATATCCAGTG
GTATCTGCATCAGGCGCTGACTAAGGCGGGCGTACCGTGGGACAGGTGGACAGCTGTTATCCGTCAGGAC
CTGGCGTTACTGCTGGAACGCCTGCCAGGGCTGGAAAATCTGGCATGGAACGACGGCACGCCGTTCGCCG
ATGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCATGGCTTGCGGGGAA
AGCCGCTGTACCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGCACTGGCGATGGCA
GACAGTCAGGGCGTGGAAGCGGCGCTGGGCTGGATACAGACCCGTCCGGGCATCACCACGGCACGACAGC
GCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAGATGGCGCTCCTGCT
GCTGGAAGAACTGGATACCGCCGCACAGGGAATAACGCTGACGCAGTGGGAGCCAGAACTGCTGTTTGAA
GTAAAAGCCCGGCAACTGAAACTGCTGCGTCTGCGGGCGCACCGCTATGCGGATAAAGCCCTGCTGAACC
GAAAAATGGAAATCCTGCTGGGAACGCTGGTGGCAATCGATCCGGCACGGGCAGCGGTACTGTGTGATAC
GCAACATAAGGACTGA