SecReT6
Protein ID: 386600819
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3206
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3277058..3278641 [+]
Producthypothetical protein
NotePAAR
UniProt IDD5CZA3
KEGG IDeih:ECOK1_3206
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.10E-11, Aligned region: 11..68
Protein Sequence: 527 a.a.     [Download]
>gi|386600819|ref|YP_006102325.1| hypothetical protein ECOK1_3206 [Escherichia coli IHE3034]
MAMGTGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDIHGRLMAGS
LDSQSSCPCKARFIASMMDDTYETDDGGSEPEQHAQSARKNLTSGNPDKKYSHQIKLQHGENNVSVQDIP
YVFILNNNMSLSGKTNQDGETERIYTDTAQKVIALTGKLADSWLKRGKNFGSLKEIDNRKIELTTEENEP
VKYVNWINGRDYIVIVAARTAVTNWIGMEDSKGNQYRFINCGLEQLQQFPPASKQDSSSQRIMVVFSLGY
TQKDIDRINDYTKAHDGRIIYVKNKDELVSFLNQRKEKGRVIKELVILCHGVIKTASYHYHHEDKDIEKN
GMFKHEDIAAVHESVFDYDAHVTTYACRAGISDGDKDFSGKDDAGQKDSPAQKMADNWDVMVKAFEMRSD
YSLAYGTGKEIKEAQEYGSVVEKYKKDIDMYNKEKAKGNTEVSPPVKPEGYDEKSKRHADVTTRDKNEKS
GGGPIAPNGAWHMPRTGDSPKGLKSGLQDYQPEEWVQ
 
Nucleotide Sequence: 1584 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3277058-3278641 Escherichia coli IHE3034 chromosome, complete genome
ATGGCAATGGGAACAGGCTACTTTCTGGTCAGGGGGGACAAAACCACCTGCGGCGGGAAGATTATTGAAG
GCGCGGACGACCATACGATCATGGGTATCCCACAGGCACGGGATATGGATCGGGTCACCTGCGGCAGATA
TCCGGGAATGTTTATTATTGTGGGCGGCGTGCCGGAAACGGATATTCACGGCAGGCTGATGGCGGGATCT
CTGGACAGCCAGAGCAGTTGCCCGTGCAAGGCGCGGTTTATTGCGTCAATGATGGATGATACCTATGAAA
CGGATGACGGGGGAAGCGAGCCGGAACAACATGCGCAGTCGGCGAGGAAAAATCTGACTTCCGGTAATCC
AGATAAAAAATACAGTCATCAGATAAAACTTCAACATGGCGAAAATAATGTTAGTGTACAGGACATACCT
TATGTCTTTATCCTAAATAATAACATGTCTCTCAGTGGCAAGACTAATCAGGATGGCGAGACTGAGAGAA
TATATACAGATACTGCTCAAAAGGTAATTGCACTTACAGGAAAACTGGCTGATTCCTGGCTGAAAAGAGG
GAAAAATTTTGGTTCATTAAAAGAAATTGACAATAGAAAGATCGAATTAACAACTGAAGAGAATGAACCT
GTAAAATATGTCAACTGGATTAATGGGCGTGATTATATTGTGATTGTGGCGGCCAGAACAGCCGTAACAA
ACTGGATAGGAATGGAGGACTCAAAAGGAAATCAGTATCGATTTATAAATTGTGGATTAGAACAATTACA
ACAGTTTCCTCCAGCCAGTAAACAGGATTCCAGTTCGCAGCGAATTATGGTGGTTTTTTCGCTTGGGTAT
ACGCAAAAAGATATTGATAGAATTAATGATTATACTAAAGCGCACGATGGAAGAATTATCTATGTCAAGA
ATAAGGATGAATTAGTTTCATTCCTGAATCAACGCAAAGAAAAAGGAAGAGTGATTAAGGAACTGGTTAT
TCTGTGCCACGGTGTTATTAAAACAGCTTCATATCATTATCATCATGAAGACAAGGATATTGAAAAAAAT
GGAATGTTTAAACATGAAGATATTGCAGCAGTTCACGAGTCAGTTTTTGATTATGATGCCCATGTGACAA
CATATGCCTGTCGGGCCGGTATCTCAGATGGTGATAAAGATTTTTCCGGGAAGGATGATGCAGGGCAAAA
GGACAGCCCGGCACAGAAAATGGCTGATAACTGGGATGTCATGGTTAAAGCGTTTGAGATGAGATCGGAC
TACAGTCTGGCTTATGGGACAGGCAAGGAAATTAAAGAAGCTCAGGAATATGGTAGTGTGGTAGAAAAAT
ATAAAAAAGATATAGATATGTATAATAAAGAAAAAGCAAAGGGGAATACTGAAGTTTCCCCTCCAGTGAA
ACCAGAGGGATATGATGAGAAATCAAAACGCCATGCAGATGTTACTACCAGAGACAAAAATGAAAAGTCT
GGCGGAGGACCAATAGCTCCTAATGGTGCATGGCATATGCCAAGAACAGGGGATTCGCCGAAAGGGCTGA
AAAGCGGGTTACAGGATTATCAGCCTGAGGAGTGGGTTCAATAA