SecReT6
Protein ID: 386600823
SecReT6 ID623
T6SS typei2
Gene symbolvasA
Locus tagECOK1_3210
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3280340..3282100 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDD5CZA7
KEGG IDeih:ECOK1_3210
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.60E-186, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|386600823|ref|YP_006102329.1| type VI secretion protein [Escherichia coli IHE3034]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLSDFQVLSRPVGERRTRCVYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFACGPLVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQDR
RMLGAHFSPMGFEDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLEQVAWPEGITGFEIDVVLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDSDRMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3280340-3282100 Escherichia coli IHE3034 chromosome, complete genome
ATGGACGACCTGACCCAACGCTACTATGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAATTCG
CACAGGCGTATCCCGACCGTGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
GCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGATCTGCCGGAA
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCCCACTACCTGCGAACCATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAGCGATTTTCAGGTATTGTCGCGCCC
TGTTGGCGAGCGCAGAACCCGCTGCGTCTACAGTGCCACGCGTGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGCGTGCGGCCCGC
TGGTTGGTGACTGGTCGCAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGACAGCCCGGTAGC
CTGTGCGTTGCACCGGGCTTTAACGCTTGGCACGCAGCAGTTCTGGCTGCGTCTGCCGGGGCAGGATCGC
CGGATGCTTGGCGCACACTTTTCCCCGATGGGCTTTGAGGATGATGACAGGCTCTGGCCAAAAGGTGAGT
CAGCCTTCAGCGGTTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTCGTGGCGCT
GAACGGGCTGGAGCAGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGGTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAACCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTACGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCA
TATGTCCCCTTTTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGCTTGCACGACACATGGCTGATTCTGGGCGGCGATGCGTTTGA
TTCCGACCGGATGCTGGAGGATGAAACCCTGTCCTTAAGTCTGACCGGCACCAACGGGCAGCTTCCCCGT
AAAGCCTTACAGAGCACCCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCCCCGACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
CGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTCTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA