SecReT6
Protein ID: 386600824
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3211
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3282064..3283143 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDD5CZA8
KEGG IDeih:ECOK1_3211
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|386600824|ref|YP_006102330.1| type VI secretion protein [Escherichia coli IHE3034]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQKAPLGSTDNPAADAVRFRPHPGMGFPVSELKNV
ERDVDNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPAFSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3282064-3283143 Escherichia coli IHE3034 chromosome, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGAGCCAGCAGAAAGCGCCGCTGGGCAGTACCGACAACCC
CGCCGCCGATGCGGTGCGTTTTCGCCCCCATCCCGGAATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGTGGACAATCCCGACGCGCCACCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGG
ATTCACCGCTGCCCACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCCGTGGATGACATTTCCCGTTGTCTGCTGGGGTTAATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCTGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
CACCCGCACGGCTGAAGGCGTCACGGCACTGGTGGGGCTGCTTGCCCCGCTGACGAAAGCCACGGTGGTG
CCTCACGATCCGCAGCCTGTAATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGTACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTGCCCGGCGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGTGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTTTCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA