SecReT6
Protein ID: 386600825
SecReT6 ID623
T6SS typei2
Gene symbol-
Locus tagECOK1_3212
StrainEscherichia coli IHE3034
Repliconchromosome [GenBank: NC_017628] [Browse all T6SS(s) in this replicon]
Location [Strand]3283124..3283660 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDD5CZA9
KEGG IDeih:ECOK1_3212
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.10E-36, Aligned region: 19..168
Protein Sequence: 178 a.a.     [Download]
>gi|386600825|ref|YP_006102331.1| type VI secretion lipoprotein [Escherichia coli IHE3034]
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALNTDAEDTPLST
MVHVWQLKTREDFDKADYDTLFMQEEKTLEKDVLAKHTVWVKPEGTASLNVPLDKETQFVAIIGQFYHPD
EKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
 
Nucleotide Sequence: 537 bp     [Download]
>gi|386597751|ref|NC_017628.1|:3283124-3283660 Escherichia coli IHE3034 chromosome, complete genome
ATGTTTCCTATTCGTTTTAAACGTCCGGCGTTGCTCTGTATGGCGATGCTGACGGTTGTTCTGAGTGGCT
GCGGGCTGATTCAGAAAGTGGTGGATGAATCGAAAAGCGTGGCCTCAGCCGTTTTCTACAAACAAATCAA
AATACTGCATCTCGATTTCTTCTCCCGCAGCGCCCTGAATACGGATGCGGAAGATACGCCGCTTTCCACG
ATGGTGCATGTCTGGCAACTGAAAACCCGCGAAGATTTTGACAAGGCGGATTACGACACCCTGTTTATGC
AGGAAGAGAAGACGCTGGAGAAGGACGTACTGGCAAAACACACCGTCTGGGTAAAACCGGAAGGCACGGC
ATCCCTGAATGTGCCGCTGGATAAAGAGACGCAGTTTGTCGCCATTATTGGGCAGTTTTATCACCCTGAT
GAAAAAAGCGACAGCTGGCGTCTGGTGATCAAAAGGGACGAACTGGAGGCCGACAAGCCGCGCTCGATTG
AACTGATGAGAAGCGACCTGCGACTGCTGCCTCTCAAGGATAAATAA