SecReT6
Protein ID: 386603114
SecReT6 ID625
T6SS typei2
Gene symbol-
Locus tagUM146_02395
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]512336..513415 [-]
Producthypothetical protein
NoteTssG
UniProt IDE1S097
KEGG IDelu:UM146_02395
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.90E-81, Aligned region: 19..319
Protein Sequence: 359 a.a.     [Download]
>gi|386603114|ref|YP_006109414.1| hypothetical protein UM146_02395 [Escherichia coli UM146]
MDRASQPARTGLTDRLAPDIARINFYRFCQLLEQSQQKAPLGSTDNPAADAVRFRPHPGMGFPVSELKNV
ERDVDNPDAPPTVRTTFLGLYGVDSPLPTAYLDYITQRHDGHDAVMAFLDIFNHRFITQYYRIWRKYNYP
ASFEAGAVDDISRCLLGLIGLGIPGSENHIATPVSRFLALLSVMRLPTRTAEGVTALVGLLAPLTKATVV
PHDPQPVILPAPAGLSKNSRISLKTRTLLGRTGTDVNSQLLLKLYTEDAAEARGWLPGGQLHSDLLVLLR
VYLGWRCQARLQLTLPVSLLPAARLGKQRVQISRTGILRASFAAPATGTVTVSLGRYQGLIPAFSIRNRE
SMTHVSYSF
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|386602643|ref|NC_017632.1|:c513415-512336 Escherichia coli UM146 chromosome, complete genome
ATGGACAGAGCATCACAGCCAGCGCGTACCGGGCTGACCGACCGGCTGGCCCCGGATATTGCGCGGATCA
ATTTTTACCGTTTTTGCCAGTTGCTGGAACAGAGCCAGCAGAAAGCGCCGCTGGGCAGTACCGACAACCC
CGCCGCCGATGCGGTGCGTTTTCGCCCCCATCCCGGAATGGGCTTTCCGGTCAGCGAGTTAAAGAACGTT
GAACGTGACGTGGACAATCCCGACGCGCCACCCACGGTGCGCACCACCTTTCTCGGCCTGTACGGCGTGG
ATTCACCGCTGCCCACCGCCTATCTGGACTACATTACCCAGCGTCATGACGGACATGACGCAGTGATGGC
GTTTCTCGATATTTTTAACCATCGCTTTATCACCCAGTATTACCGCATCTGGCGCAAATATAACTACCCG
GCGTCGTTTGAAGCAGGTGCCGTGGATGACATTTCCCGTTGTCTGCTGGGGTTAATCGGGCTGGGTATTC
CCGGCAGCGAGAACCATATCGCCACGCCTGTATCCCGTTTTCTGGCCCTGCTCAGCGTGATGCGCCTGCC
CACCCGCACGGCTGAAGGCGTCACGGCACTGGTGGGGCTGCTTGCCCCGCTGACGAAAGCCACGGTGGTG
CCTCACGATCCGCAGCCTGTAATTCTCCCGGCCCCTGCGGGTCTGTCAAAAAATTCACGCATCAGCCTGA
AAACGCGAACGCTGCTGGGGCGTACCGGTACCGACGTCAACAGCCAGTTGCTGCTGAAACTGTATACCGA
AGATGCCGCAGAAGCACGTGGCTGGCTGCCCGGCGGGCAACTGCACAGCGATTTGCTGGTGCTGCTGCGC
GTTTATCTGGGCTGGCGCTGTCAGGCCCGTCTGCAACTGACGCTGCCCGTCAGCCTGTTGCCTGCTGCCC
GGCTGGGAAAACAGCGTGTACAGATTAGCCGTACCGGCATCCTTCGCGCCTCCTTTGCCGCGCCCGCGAC
CGGAACAGTGACGGTCAGTCTGGGGCGTTATCAGGGATTAATACCCGCTTTTTCCATTCGTAACAGGGAG
AGTATGACTCATGTTTCCTATTCGTTTTAA