SecReT6
Protein ID: 386603115
SecReT6 ID625
T6SS typei2
Gene symbol-
Locus tagUM146_02400
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]513379..515139 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDE1S098
KEGG IDelu:UM146_02400
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 8.60E-186, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|386603115|ref|YP_006109415.1| type VI secretion protein [Escherichia coli UM146]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLSDFQVLSRPVGERRTRCVYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFACGPLVGDWSQIDLSRLPLYLNADSPVACALHRALTLGTQQFWLRLPGQDR
RMLGAHFSPMGFEDDDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLEQVAWPEGITGFEIDVVLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDSDRMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|386602643|ref|NC_017632.1|:c515139-513379 Escherichia coli UM146 chromosome, complete genome
ATGGACGACCTGACCCAACGCTACTATGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGTAAAGAATTCG
CACAGGCGTATCCCGACCGTGCTGCGATGCTTAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
GCGCCTGTTCGAGGGCTTCGCTTTTTTAATGGGCCGCCTGCGCGAAAAGCTGGACGACGATCTGCCGGAA
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCCCACTACCTGCGAACCATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAGCGATTTTCAGGTATTGTCGCGCCC
TGTTGGCGAGCGCAGAACCCGCTGCGTCTACAGTGCCACGCGTGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGCTCGGTTATCCGTCTGCGCTTTGCGTGCGGCCCGC
TGGTTGGTGACTGGTCGCAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGACAGCCCGGTAGC
CTGTGCGTTGCACCGGGCTTTAACGCTTGGCACGCAGCAGTTCTGGCTGCGTCTGCCGGGGCAGGATCGC
CGGATGCTTGGCGCACACTTTTCCCCGATGGGCTTTGAGGATGATGACAGGCTCTGGCCAAAAGGTGAGT
CAGCCTTCAGCGGTTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTCGTGGCGCT
GAACGGGCTGGAGCAGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGGTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAACCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTACGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCA
TATGTCCCCTTTTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGCTTGCACGACACATGGCTGATTCTGGGCGGCGATGCGTTTGA
TTCCGACCGGATGCTGGAGGATGAAACCCTGTCCTTAAGTCTGACCGGCACCAACGGGCAGCTTCCCCGT
AAAGCCTTACAGAGCACCCTGCTCGATACGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCCCCGACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
CGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGCACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTCTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCCACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA