SecReT6
Protein ID: 386603119
SecReT6 ID625
T6SS typei2
Gene symbol-
Locus tagUM146_02420
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]516838..518421 [-]
Producthypothetical protein
NotePAAR
UniProt IDE1S0A2
KEGG IDelu:UM146_02420
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 3.10E-11, Aligned region: 11..68
Protein Sequence: 527 a.a.     [Download]
>gi|386603119|ref|YP_006109419.1| hypothetical protein UM146_02420 [Escherichia coli UM146]
MAMGTGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDIHGRLMAGS
LDSQSSCPCKARFIASMMDDTYETDDGGSEPEQHAQSARKNLTSGNPDKKYSHQIKLQHGENNVSVQDIP
YVFILNNNMSLSGKTNQDGETERIYTDTAQKVIALTGKLADSWLKRGKNFGSLKEIDNRKIELTTEENEP
VKYVNWINGRDYIVIVAARTAVTNWIGMEDSKGNQYRFINCGLEQLQQFPPASKQDSSSQRIMVVFSLGY
TQKDIDRINDYTKAHDGRIIYVKNKDELVSFLNQRKEKGRVIKELVILCHGVIKTASYHYHHEDKDIEKN
GMFKHEDIAAVHESVFDYDAHVTTYACRAGISDGDKDFSGKDDAGQKDSPAQKMADNWDVMVKAFEMRSD
YSLAYGTGKEIKEAQEYGSVVEKYKKDIDMYNKEKAKGNTEVSPPVKPEGYDEKSKRHADVTTRDKNEKS
GGGPIAPNGAWHMPRTGDSPKGLKSGLQDYQPEEWVQ
 
Nucleotide Sequence: 1584 bp     [Download]
>gi|386602643|ref|NC_017632.1|:c518421-516838 Escherichia coli UM146 chromosome, complete genome
ATGGCAATGGGAACAGGCTACTTTCTGGTCAGGGGGGACAAAACCACCTGCGGCGGGAAGATTATTGAAG
GCGCGGACGACCATACGATCATGGGTATCCCACAGGCACGGGATATGGATCGGGTCACCTGCGGCAGATA
TCCGGGAATGTTTATTATTGTGGGCGGCGTGCCGGAAACGGATATTCACGGCAGGCTGATGGCGGGATCT
CTGGACAGCCAGAGCAGTTGCCCGTGCAAGGCGCGGTTTATTGCGTCAATGATGGATGATACCTATGAAA
CGGATGACGGGGGAAGCGAGCCGGAACAACATGCGCAGTCGGCGAGGAAAAATCTGACTTCCGGTAATCC
AGATAAAAAATACAGTCATCAGATAAAACTTCAACATGGCGAAAATAATGTTAGTGTACAGGACATACCT
TATGTCTTTATCCTAAATAATAACATGTCTCTCAGTGGCAAGACTAATCAGGATGGCGAGACTGAGAGAA
TATATACAGATACTGCTCAAAAGGTAATTGCACTTACAGGAAAACTGGCTGATTCCTGGCTGAAAAGAGG
GAAAAATTTTGGTTCATTAAAAGAAATTGACAATAGAAAGATCGAATTAACAACTGAAGAGAATGAACCT
GTAAAATATGTCAACTGGATTAATGGGCGTGATTATATTGTGATTGTGGCGGCCAGAACAGCCGTAACAA
ACTGGATAGGAATGGAGGACTCAAAAGGAAATCAGTATCGATTTATAAATTGTGGATTAGAACAATTACA
ACAGTTTCCTCCAGCCAGTAAACAGGATTCCAGTTCGCAGCGAATTATGGTGGTTTTTTCGCTTGGGTAT
ACGCAAAAAGATATTGATAGAATTAATGATTATACTAAAGCGCACGATGGAAGAATTATCTATGTCAAGA
ATAAGGATGAATTAGTTTCATTCCTGAATCAACGCAAAGAAAAAGGAAGAGTGATTAAGGAACTGGTTAT
TCTGTGCCACGGTGTTATTAAAACAGCTTCATATCATTATCATCATGAAGACAAGGATATTGAAAAAAAT
GGAATGTTTAAACATGAAGATATTGCAGCAGTTCACGAGTCAGTTTTTGATTATGATGCCCATGTGACAA
CATATGCCTGTCGGGCCGGTATCTCAGATGGTGATAAAGATTTTTCCGGGAAGGATGATGCAGGGCAAAA
GGACAGCCCGGCACAGAAAATGGCTGATAACTGGGATGTCATGGTTAAAGCGTTTGAGATGAGATCGGAC
TACAGTCTGGCTTATGGGACAGGCAAGGAAATTAAAGAAGCTCAGGAATATGGTAGTGTGGTAGAAAAAT
ATAAAAAAGATATAGATATGTATAATAAAGAAAAAGCAAAGGGGAATACTGAAGTTTCCCCTCCAGTGAA
ACCAGAGGGATATGATGAGAAATCAAAACGCCATGCAGATGTTACTACCAGAGACAAAAATGAAAAGTCT
GGCGGAGGACCAATAGCTCCTAATGGTGCATGGCATATGCCAAGAACAGGGGATTCGCCGAAAGGGCTGA
AAAGCGGGTTACAGGATTATCAGCCTGAGGAGTGGGTTCAATAA