SecReT6
Protein ID: 386603123
SecReT6 ID625
T6SS typei2
Gene symbol-
Locus tagUM146_02440
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]524525..524785 [-]
Producthypothetical protein
NotePAAR
UniProt IDE1S0A6
KEGG IDelu:UM146_02440
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.20E-22, Aligned region: 7..78
Protein Sequence: 86 a.a.     [Download]
>gi|386603123|ref|YP_006109423.1| hypothetical protein UM146_02440 [Escherichia coli UM146]
MPGIVCLGDATTHGGKVITATSTLFINGIQVALVGDLVSCPKHGVNPIQEGDPTATEKGRNVVVNHCQCA
CGCRVISSQPENSIES
 
Nucleotide Sequence: 261 bp     [Download]
>gi|386602643|ref|NC_017632.1|:c524785-524525 Escherichia coli UM146 chromosome, complete genome
ATGCCTGGGATCGTTTGTTTAGGTGATGCCACGACTCATGGTGGTAAGGTGATTACCGCAACTTCAACGC
TTTTTATCAATGGCATTCAGGTAGCTCTCGTAGGTGATCTGGTTTCCTGCCCAAAGCACGGCGTGAATCC
CATACAAGAAGGTGACCCGACAGCGACGGAAAAAGGTCGTAATGTCGTTGTTAATCATTGCCAATGTGCA
TGTGGCTGTAGGGTTATCAGTTCTCAACCAGAAAATAGTATCGAGTCATAA