SecReT6
Protein ID: 386603130
SecReT6 ID625
T6SS typei2
Gene symbol-
Locus tagUM146_02485
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]536313..537650 [-]
Producthypothetical protein
NoteTssK
UniProt IDE1S0B3
KEGG IDelu:UM146_02485
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.80E-131, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|386603130|ref|YP_006109430.1| hypothetical protein UM146_02485 [Escherichia coli UM146]
MKIHRPLWAEGTFLSSQQFQQQARWEAFSNDCIAQLCIRHPWGIANVLFDRDALTPGKLKTQAVRLRFAD
GTLIDSDVSDVLPLACDLRALKNDSAIVLLALPLAHGNGGNLGQGEQTERPLRYRQEWQKVQDIYGSDSE
DMAVERHALSLRFAHDNNQDYITCPLARLVRDVQGNWTQDESYIPPLLAFNAHDGLVQRLDTLLLQLRAK
CQRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLSDFLRYPAVHPELVWRELARLAGALLTFSLE
HNVSAVPPYVHESPSTVFPPLFSLLSELLEASLPSRVIALDLASLPGNRWKADLHDPRLREEADFYLSVR
SSLPAHQVLHQLPLVCKIGAPDDVTLLINVALNGVQLVPLTSVPAALPLRLENQYFALDMHSDAAKSMLE
SGSCMIYAPGTMGDLKPELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|386602643|ref|NC_017632.1|:c537650-536313 Escherichia coli UM146 chromosome, complete genome
ATGAAAATTCATCGACCACTGTGGGCTGAGGGGACATTCCTGTCCTCTCAGCAGTTTCAGCAGCAGGCCC
GCTGGGAAGCGTTCAGCAATGACTGTATTGCGCAGCTTTGTATTCGCCATCCGTGGGGGATCGCAAACGT
GCTCTTTGACCGGGATGCCCTGACGCCCGGAAAGCTGAAAACGCAGGCAGTACGCCTGCGTTTTGCTGAT
GGCACGCTGATCGATTCAGACGTGAGTGACGTTCTGCCGCTCGCCTGCGATCTGCGCGCGCTGAAGAACG
ACAGCGCGATTGTTTTGCTGGCGCTGCCGCTTGCACATGGTAACGGCGGTAATCTCGGTCAGGGTGAGCA
GACTGAAAGACCGCTGCGCTATCGTCAGGAATGGCAAAAGGTGCAGGATATCTACGGCAGTGACAGTGAA
GATATGGCCGTTGAGCGTCATGCGCTGTCCCTGCGCTTTGCTCATGATAACAATCAGGATTACATCACCT
GCCCACTGGCGCGTCTGGTGCGGGATGTTCAGGGCAACTGGACACAGGATGAGAGCTATATTCCGCCGTT
ACTGGCGTTTAACGCCCATGACGGGCTGGTACAGCGTCTGGACACATTGCTGTTGCAGCTACGGGCGAAG
TGCCAGCGTCTGATGGCGATGCGCCGGGAAAGCAACCAGCGTATGGCGGACTTTGCCGTCGCCGATGTCT
CCCTGTTCTGGCTGCTTAACGCGCTGAATTCCGCCGAGCCGGTGCTGAGCGATTTCCTGCGCTACCCGGC
TGTCCACCCCGAACTGGTCTGGCGGGAGCTGGCGAGGCTTGCCGGTGCGCTGCTGACGTTTTCCCTTGAG
CATAACGTCAGCGCCGTTCCGCCCTATGTCCACGAATCGCCGTCCACCGTCTTTCCGCCCCTGTTCTCCC
TGCTCAGCGAGCTGCTGGAAGCCAGCCTGCCGTCGCGGGTGATCGCGCTGGATCTGGCGTCCCTGCCGGG
CAACCGCTGGAAAGCCGACCTGCACGATCCGCGACTGCGGGAAGAGGCCGATTTTTATCTGTCCGTTCGT
TCCTCACTGCCTGCGCATCAGGTACTGCATCAGCTACCGCTGGTCTGCAAAATCGGTGCGCCCGATGATG
TCACGCTGCTTATCAACGTGGCGCTGAACGGTGTTCAACTGGTGCCGCTTACCTCGGTTCCGGCGGCGCT
GCCGCTGCGGCTGGAGAACCAGTATTTTGCGCTGGATATGCACAGTGACGCGGCTAAATCGATGCTGGAG
TCCGGGAGCTGCATGATTTATGCGCCGGGAACCATGGGCGACCTGAAACCTGAACTGTTTGCGGTGCTGC
GCACATGA