SecReT6
Protein ID: 386605803
SecReT6 ID626
T6SS typei1
Gene symbol-
Locus tagUM146_16160
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]3352878..3353396 [-]
Producthypothetical protein
NoteTssD
UniProt IDE1S3C1
KEGG IDelu:UM146_16160
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.30E-36, Aligned region: 6..155
DCAF15_WD40 [PF14939], Evalue: 0.0034, Aligned region: 93..137
Protein Sequence: 172 a.a.     [Download]
>gi|386605803|ref|YP_006112103.1| hypothetical protein UM146_16160 [Escherichia coli UM146]
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPSGQRAHKPFIF
TVALNKAVPLLYNALASGEMLPKVELHWWRTSVEGKQEHYFTTRLTDATIVDMNLHMPHCQDPAQREFTQ
LLAVSLAYRKVEWEHIKSGTSGADDWRAPLEA
 
Nucleotide Sequence: 519 bp     [Download]
>gi|386602643|ref|NC_017632.1|:c3353396-3352878 Escherichia coli UM146 chromosome, complete genome
ATGCCAACCCCATGTTACATTTCAATTACAGGTCAGACCCAGGGGAACATCACTGCCGGTGCTTTCACCG
CAGATTCTGTCGGCAATATCTACGTGCAGGGACACGAAGATGAAATGCTGGTGCAGGAGTTTCTGCATAA
CGTTACTGTTCCAACCGATCCGCAGTCTGGTCAGCCTTCCGGGCAGCGTGCTCACAAACCGTTCATTTTC
ACCGTGGCGCTGAACAAAGCCGTTCCGCTGCTGTACAACGCGCTGGCCTCCGGTGAAATGCTGCCGAAAG
TGGAGCTGCACTGGTGGCGTACCTCTGTTGAAGGCAAGCAGGAGCACTACTTCACCACACGTCTTACTGA
CGCGACGATTGTGGACATGAACCTGCATATGCCGCACTGCCAGGACCCTGCACAGCGTGAGTTTACGCAA
TTGCTCGCAGTATCACTGGCCTACCGTAAGGTTGAGTGGGAGCACATCAAATCCGGTACTTCTGGTGCCG
ATGACTGGCGTGCACCGCTGGAAGCATAA