SecReT6
Protein ID: 386605805
SecReT6 ID626
T6SS typei1
Gene symbol-
Locus tagUM146_16170
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]3354628..3356112 [+]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDE1S3C3
KEGG IDelu:UM146_16170
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 8.20E-183, Aligned region: 67..491
Protein Sequence: 494 a.a.     [Download]
>gi|386605805|ref|YP_006112105.1| type VI secretion protein EvpB [Escherichia coli UM146]
MSVKEEIAPVSASQTAAPPSLLDEIMAQTRVQPKSESYDITRQGVSAFIAAMLQGDSSAEPINILAVDAM
IADIDARTSRQMDAIIHAPEFQELESLLRSLKLLVERADTRENIKVHFLNVTQEELLDDFEFAPEITQSA
YYKHVYSSGYGQFGGEPVAAVIGNFAFKNTTPDMKLLKYISQVSAMAHSPFLSSVSSEFFGLDSWTELPG
IKEPGAIFEGPAYSRWRALRESEDSRYLGLTAPRFLLRHPYSPDENPVKTFRYHEDVSQSHESYLWGNTS
FLLAANLAESFAKYRWCPNIIGPSSGGAVKDLPVHLYESMGQMQAKIPTEVLITDRREYELAEEGFITLT
MRKGSDNACFFSANSVQKPKTFPKTPEGKAAETNYKLGTQLPYLFVISRLAHYIKVIQREQLGSWKERSD
LERELNTWIRQYVADQENPPAEVRSHRPLRQAKIEVLDVDGEPGWYQVAISVRPHFKYMGASFDLSLVGR
LDKE
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|386602643|ref|NC_017632.1|:3354628-3356112 Escherichia coli UM146 chromosome, complete genome
ATGTCAGTAAAGGAAGAAATTGCTCCCGTCAGCGCGTCTCAAACCGCCGCGCCCCCATCTCTGCTTGATG
AAATCATGGCGCAAACCCGCGTCCAGCCTAAATCAGAAAGCTACGATATCACCCGCCAGGGCGTGAGCGC
CTTTATTGCCGCCATGTTACAGGGCGACAGTAGCGCTGAACCTATCAATATCCTGGCCGTTGACGCCATG
ATTGCTGATATTGATGCCCGAACCAGCAGGCAGATGGATGCCATTATTCATGCCCCGGAGTTTCAGGAAC
TGGAATCCCTGCTGCGCTCGCTGAAGCTGCTGGTTGAACGCGCGGATACACGGGAAAACATCAAAGTCCA
TTTCCTGAATGTCACTCAGGAAGAACTGCTGGATGATTTCGAATTTGCACCTGAAATCACGCAGTCTGCG
TATTACAAGCATGTATATTCAAGCGGTTACGGACAATTTGGCGGTGAGCCAGTGGCGGCGGTAATCGGCA
ACTTTGCCTTTAAGAACACCACGCCGGATATGAAGCTGCTGAAATATATCAGCCAGGTCAGCGCGATGGC
GCACAGCCCGTTCCTGTCGTCAGTATCATCCGAATTTTTCGGTCTGGATTCATGGACAGAGTTACCGGGG
ATCAAAGAACCGGGTGCCATCTTTGAAGGCCCGGCCTACTCCCGCTGGCGCGCCCTGCGTGAATCGGAAG
ATTCCCGTTACCTGGGCCTGACCGCCCCCCGGTTCCTGCTGCGCCACCCTTACTCACCGGATGAAAACCC
TGTCAAAACCTTCCGTTACCATGAAGATGTCAGCCAGAGTCATGAGTCTTATCTGTGGGGGAATACCTCG
TTTTTACTGGCCGCCAACCTGGCGGAAAGTTTTGCTAAGTATCGCTGGTGCCCAAATATTATTGGCCCTT
CCAGCGGCGGCGCAGTCAAAGACCTCCCGGTGCATCTGTATGAATCCATGGGGCAAATGCAGGCAAAAAT
TCCGACTGAAGTGTTGATCACTGACCGGAGAGAGTATGAGCTGGCGGAAGAGGGCTTTATCACACTGACC
ATGCGTAAAGGGTCTGATAATGCGTGCTTTTTCTCGGCCAACTCGGTGCAGAAACCCAAAACATTCCCCA
AAACCCCCGAAGGCAAGGCTGCGGAGACCAACTATAAACTCGGCACCCAGCTGCCATACTTGTTTGTTAT
CAGCAGGTTAGCGCATTACATCAAGGTAATTCAGCGCGAACAGCTTGGCTCATGGAAAGAACGTAGTGAC
CTGGAGCGTGAGCTGAACACCTGGATTCGCCAGTATGTTGCTGACCAGGAAAATCCGCCTGCCGAAGTCC
GCAGCCACCGGCCTTTGCGTCAGGCTAAGATCGAGGTACTGGATGTGGATGGTGAGCCGGGCTGGTACCA
GGTCGCGATTTCTGTCAGACCGCATTTTAAATACATGGGTGCCAGTTTCGACCTGAGCCTGGTCGGACGA
CTGGATAAGGAATAA