SecReT6
Protein ID: 386605807
SecReT6 ID626
T6SS typei1
Gene symbol-
Locus tagUM146_16180
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]3356548..3358389 [+]
Producthypothetical protein
NoteTssF
UniProt IDE1S3C5
KEGG IDelu:UM146_16180
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.30E-190, Aligned region: 5..613
Protein Sequence: 613 a.a.     [Download]
>gi|386605807|ref|YP_006112107.1| hypothetical protein UM146_16180 [Escherichia coli UM146]
MAFEERYYREELDYLRQLGKLLAQEKPHLAHFLAEKEGDPDVERLMEAFAFMSGSLRQKLEDEFPEFTHG
LIRMLWANYLRPVPAMTVIAYEPKTDQLKVPVQVCRNELIRSRSEKSSLTAQKVLPDNHDKIVSSVACHF
TLARDIWLQPLRILDTRNASSLKEGIIDISFTADNNVSPAMLDLNKITFWLGNEDDYTRHQLYLWFCECL
MDAELIAGEYRLPLPDLWLEAAGFDNRDALLPWPKNVHSGYRVLQEYFCYPEAFFFFHLRDVAPLPDDFP
INAFTLRLHFNRPLPADIKLRQDSLRLHCTPAINLFTHYAEPVRPDGRMAEYPLRASHKHPDAYDIFQVS
TVTSKVKVSGTEISPGSQARVWPEFESFQHQMEYSRQREVVYWHHRTKTSLLHHGLEHSIAFVHADGSIP
GSSRFNDDVITTSLICTNRMIPARLHTGDICVAVNKNPAVASFRNVTRPTLPLWPVTDGDMHWSLISAMN
LNYLSLLDRETLIQILRTFDLPGAHHPQRARLSRQKLDAIEKLETKPVDRLFKGVPVRGLATTLWIRPDP
FICEGEIYLLGTVLSHFFALYASINSYHCLKIINTESQESWEWQEKMGQHALI
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|386602643|ref|NC_017632.1|:3356548-3358389 Escherichia coli UM146 chromosome, complete genome
GTGGCTTTTGAAGAACGTTACTACCGCGAAGAGCTGGATTATCTTCGCCAGCTAGGCAAACTGCTGGCGC
AGGAAAAACCACATCTGGCCCACTTTCTGGCCGAGAAAGAGGGTGATCCGGACGTGGAGCGTCTGATGGA
AGCCTTTGCCTTTATGTCCGGTAGCCTGCGCCAGAAACTTGAGGACGAATTCCCCGAGTTCACCCATGGG
CTGATCCGTATGCTGTGGGCAAACTATTTACGCCCGGTTCCGGCCATGACGGTTATTGCCTATGAACCCA
AAACCGATCAGTTAAAAGTCCCTGTTCAGGTCTGTCGTAATGAACTGATCAGAAGCCGCTCAGAAAAGTC
CTCCCTGACTGCTCAGAAGGTGCTGCCTGACAATCATGATAAAATCGTTTCTTCCGTAGCCTGCCATTTC
ACGCTGGCGCGCGATATCTGGCTGCAACCACTGCGCATTCTCGATACCCGCAACGCCAGCAGCCTGAAAG
AAGGCATCATAGATATCAGTTTTACCGCAGATAACAATGTCTCCCCCGCCATGCTTGACCTGAACAAAAT
CACGTTCTGGCTGGGTAATGAAGACGATTATACCCGACACCAGCTTTATCTGTGGTTTTGCGAATGCCTG
ATGGATGCGGAACTGATTGCCGGAGAGTACCGCCTGCCGCTGCCGGATCTGTGGCTGGAGGCGGCGGGTT
TTGACAACCGGGATGCTCTGCTGCCGTGGCCGAAAAATGTCCACAGCGGCTACCGCGTGCTTCAGGAGTA
TTTCTGCTATCCCGAAGCCTTCTTCTTTTTCCATCTGCGCGATGTTGCGCCGCTACCAGACGATTTCCCG
ATCAATGCGTTTACGCTGCGCCTGCACTTTAACCGCCCGTTACCTGCCGACATCAAGCTGCGCCAGGATT
CGCTGCGTCTGCACTGTACGCCAGCCATTAACCTGTTTACGCATTATGCGGAACCCGTCAGGCCGGATGG
GCGGATGGCGGAATACCCGCTGCGCGCCAGCCATAAGCATCCGGACGCCTATGACATTTTTCAGGTCAGC
ACAGTCACCAGTAAAGTCAAAGTTTCAGGTACTGAAATCAGCCCAGGTAGCCAGGCGCGTGTCTGGCCCG
AATTTGAAAGCTTCCAGCACCAGATGGAGTACAGCCGCCAGCGAGAAGTCGTCTACTGGCATCACCGGAC
TAAAACGTCCCTGCTTCACCACGGGCTTGAACACTCTATCGCCTTTGTCCATGCAGACGGTAGCATTCCG
GGCAGCTCACGGTTTAACGATGACGTGATCACCACGTCATTAATCTGTACCAACCGTATGATCCCTGCCC
GGCTGCATACCGGTGATATCTGCGTGGCCGTCAACAAAAATCCGGCAGTGGCCTCATTTCGTAATGTCAC
GCGCCCGACACTGCCGCTCTGGCCAGTCACGGACGGCGACATGCACTGGTCGCTGATTTCCGCGATGAAC
CTGAACTACCTCTCCCTGCTGGACAGGGAGACACTGATCCAGATCCTGCGGACCTTCGACCTGCCAGGTG
CTCACCATCCGCAGCGGGCCAGACTGTCACGCCAGAAACTGGATGCCATAGAAAAACTCGAAACCAAACC
TGTTGACAGGTTGTTTAAAGGCGTACCGGTTCGCGGGCTGGCGACCACGCTGTGGATACGTCCCGATCCG
TTTATCTGCGAAGGTGAAATTTATCTTCTGGGTACCGTGCTCTCGCACTTCTTTGCCCTCTACGCCAGCA
TCAATTCGTACCACTGTCTGAAAATCATTAACACGGAAAGTCAGGAGTCCTGGGAATGGCAGGAGAAAAT
GGGCCAGCACGCCCTGATATAG