SecReT6
Protein ID: 386605808
SecReT6 ID626
T6SS typei1
Gene symbol-
Locus tagUM146_16185
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]3358353..3359402 [+]
Producthypothetical protein
NoteTssG
UniProt IDE1S3C6
KEGG IDelu:UM146_16185
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.40E-90, Aligned region: 20..336
Protein Sequence: 349 a.a.     [Download]
>gi|386605808|ref|YP_006112108.1| hypothetical protein UM146_16185 [Escherichia coli UM146]
MAGENGPARPDIATKPPLPADVRNCNFYVLMEALYRRHGAPGQDISLRTEPAREIVRFSSDASISFPGTD
LSALSRSQNGQYVLQTRFLGFSGSQSPLPGYYLDQMAQESAQNEDGLKEFLDLFSHRWTQFAYHAWRKYR
YYICFRSGGTDTFSQRMYALVGLGNQSVRDRLAINHSKMLAYAGILATPGRAPEVICNLVSHCFDLPDVT
IERWQLRKVAIDPAHQNRLGVRNPKGKTAGHIPGRSILGVNFTLGARVPDRSGKFLLQIGGLSRERYLSF
LPDGENHLPLTMFLSFILRDQFAWDLRLCLAPQQAKGMRLSDPASSRLGRTSFIGQPKVPPAITIRIRE
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|386602643|ref|NC_017632.1|:3358353-3359402 Escherichia coli UM146 chromosome, complete genome
ATGGCAGGAGAAAATGGGCCAGCACGCCCTGATATAGCGACAAAACCGCCGTTACCGGCGGATGTGCGCA
ACTGCAATTTCTATGTGCTGATGGAGGCGCTGTACCGTCGGCATGGCGCGCCGGGCCAGGACATTTCCCT
GCGTACCGAGCCTGCCCGGGAGATCGTGCGTTTCAGCTCTGACGCCAGTATCAGTTTTCCGGGTACGGAC
CTGAGTGCGCTTTCCCGTAGCCAGAACGGACAGTATGTACTGCAAACCCGGTTCCTGGGTTTTTCCGGCA
GCCAGTCGCCGCTACCGGGCTATTATCTGGATCAGATGGCGCAGGAGTCCGCACAGAACGAAGACGGCCT
GAAAGAATTTCTCGATCTATTCAGCCACCGCTGGACACAGTTTGCCTATCATGCCTGGCGCAAATACCGC
TACTACATCTGCTTTCGTAGCGGCGGTACTGACACCTTTTCACAGCGCATGTACGCACTGGTCGGGCTGG
GTAATCAGAGCGTGCGTGACAGGCTTGCCATTAACCACAGCAAAATGCTGGCCTACGCCGGAATTCTGGC
AACACCAGGCCGCGCGCCGGAGGTTATCTGTAATCTGGTGTCGCACTGTTTTGATTTGCCGGATGTCACC
ATTGAACGCTGGCAACTGCGTAAAGTCGCCATTGATCCGGCACACCAGAACCGGCTGGGTGTACGTAATC
CGAAAGGAAAAACGGCTGGACATATTCCGGGACGCTCCATACTCGGCGTTAATTTTACCCTCGGCGCACG
GGTGCCGGATCGCAGCGGAAAATTCCTGTTGCAGATTGGCGGCCTGTCGCGGGAGCGTTATCTCTCATTT
TTACCCGATGGCGAAAATCACCTGCCGCTGACCATGTTCCTTTCCTTTATTCTGCGCGACCAGTTTGCCT
GGGATTTACGGCTGTGCCTGGCGCCACAGCAGGCTAAAGGGATGCGCCTTAGCGATCCGGCCAGCTCCCG
CCTCGGCAGAACCAGCTTTATTGGTCAGCCGAAAGTACCGCCCGCCATCACAATCCGAATCAGGGAATAA