SecReT6
Protein ID: 386605809
SecReT6 ID626
T6SS typei1
Gene symbol-
Locus tagUM146_16190
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]3359407..3360699 [+]
Producthypothetical protein
NoteFha
UniProt IDE1S3C7
KEGG IDelu:UM146_16190
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00098, Aligned region: 44..108
Protein Sequence: 430 a.a.     [Download]
>gi|386605809|ref|YP_006112109.1| hypothetical protein UM146_16190 [Escherichia coli UM146]
MEPLMAEEKQQSRQASLTLQVMNGNELESGRAAKCLFSENGGDIGHTPECHWQVQDRAGSIAARACTVIR
HDGAYCLRCLTPGLMINLAPASSDALIRLRQGDEIQLGALALKVFLHDGAAVTYDERMATPETIVMNRDS
LADTLLTTEGQPAYPGMPFQHQLAPTVAHGFSSDPLQALQTESLMVADDPIAPRVSRPVAPASDLTGANG
INTPFMDLPPGNARHEDGDEFSAMAQYHLAVTPLLRGMECPLTLHNSQDADEFLEEAGRALQAAIKGLLS
LQQQQNSLSDKHLRPLEDNPLRLDMDYATALNVMFAEGKSPVHLAAPAAIAESLRNIRHHEEANRAAIVE
ALRVMLDAFSPGNLMRRFAQYRRSHELRQKMDDAWAWQMYSNYYDELASSRQQGFEMLFNEVYAQVYDRV
LREKQREPEA
 
Nucleotide Sequence: 1293 bp     [Download]
>gi|386602643|ref|NC_017632.1|:3359407-3360699 Escherichia coli UM146 chromosome, complete genome
ATGGAACCACTTATGGCTGAGGAAAAACAGCAATCCCGCCAGGCCTCACTGACTTTACAGGTGATGAATG
GCAACGAACTGGAAAGCGGACGCGCCGCAAAATGCCTGTTCAGCGAAAACGGCGGTGATATTGGCCATAC
GCCGGAATGTCACTGGCAGGTACAGGACCGGGCGGGAAGCATTGCTGCGCGTGCCTGTACCGTTATCCGG
CACGACGGAGCCTATTGCCTGCGGTGCCTGACGCCGGGACTGATGATTAATCTGGCCCCGGCCTCTTCCG
ATGCGCTCATCCGCCTGCGCCAGGGGGATGAGATCCAGCTCGGCGCACTGGCGCTGAAAGTGTTTCTGCA
TGACGGTGCAGCTGTTACCTATGACGAGCGGATGGCGACCCCGGAAACGATTGTAATGAACCGCGACAGT
CTGGCGGACACCCTGCTGACCACCGAGGGACAACCGGCGTATCCGGGAATGCCGTTCCAGCATCAGCTTG
CCCCCACGGTGGCGCACGGTTTTTCCAGCGATCCGCTCCAGGCACTCCAGACGGAAAGCCTGATGGTGGC
AGATGATCCGATCGCCCCACGCGTTTCCCGGCCCGTAGCCCCCGCATCCGATCTGACAGGTGCAAACGGG
ATCAACACGCCGTTTATGGATCTGCCGCCCGGCAATGCCCGTCATGAGGACGGCGATGAATTTTCTGCCA
TGGCGCAGTACCACCTGGCCGTAACCCCGCTGCTGCGCGGTATGGAGTGTCCGCTGACGCTGCACAATTC
TCAGGATGCGGATGAGTTTCTCGAAGAGGCCGGACGGGCGTTGCAGGCCGCCATTAAGGGATTGCTGAGT
CTGCAACAACAACAGAACAGCCTGTCGGATAAACACCTGCGTCCACTAGAAGACAACCCGTTGCGCCTTG
ATATGGACTATGCCACCGCGCTGAACGTCATGTTCGCCGAGGGTAAAAGCCCGGTACATCTCGCAGCACC
TGCGGCCATCGCCGAAAGCCTGCGCAACATCCGGCATCATGAAGAGGCTAACCGGGCGGCGATTGTGGAA
GCGTTGCGTGTCATGCTGGACGCCTTTTCGCCGGGCAACCTGATGCGCCGCTTTGCGCAATACCGCCGCA
GCCATGAACTGCGCCAGAAAATGGACGACGCCTGGGCATGGCAGATGTACAGCAACTATTACGATGAGCT
GGCCTCCAGCCGACAGCAGGGATTTGAAATGCTGTTCAATGAAGTTTATGCCCAGGTCTATGACCGGGTG
CTGCGCGAAAAACAGCGGGAGCCGGAAGCATGA