SecReT6
Protein ID: 386605810
SecReT6 ID626
T6SS typei1
Gene symbol-
Locus tagUM146_16195
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]3360696..3361220 [+]
Producthypothetical protein
NoteTssJ
UniProt IDE1S3C8
KEGG IDelu:UM146_16195
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.40E-32, Aligned region: 14..167
Protein Sequence: 174 a.a.     [Download]
>gi|386605810|ref|YP_006112110.1| hypothetical protein UM146_16195 [Escherichia coli UM146]
MNGKAFLACVLMSVVLTGCETAKKISQVIRNPDIQVGKLMDQSTELTVTLLTEPDSNLTADGEAAPVDVQ
LVYLSDDSKFHAADYDQVATTALPDVLGKNYIDHQDFNLLPDTVKTLPPIKLDEKTGYIGVIAYFSDDQA
TEWKQIESVESIGHHYRLLVHIRASAIEMKKEEN
 
Nucleotide Sequence: 525 bp     [Download]
>gi|386602643|ref|NC_017632.1|:3360696-3361220 Escherichia coli UM146 chromosome, complete genome
ATGAACGGCAAAGCGTTTCTGGCCTGCGTTCTGATGAGCGTCGTATTAACTGGCTGTGAAACAGCGAAAA
AAATCAGCCAGGTGATCCGCAATCCGGATATTCAGGTCGGAAAGCTGATGGATCAGTCAACCGAGCTGAC
CGTCACGCTGCTGACCGAGCCGGACAGCAACCTGACGGCGGATGGCGAAGCCGCGCCGGTGGATGTCCAG
TTGGTTTATCTGAGCGACGACTCAAAATTCCATGCCGCCGACTACGACCAGGTTGCCACCACCGCGCTGC
CCGACGTGCTGGGGAAAAACTATATCGATCACCAGGACTTCAACCTGTTGCCGGATACCGTAAAAACACT
GCCGCCGATCAAGTTGGATGAGAAAACCGGTTATATCGGTGTCATTGCCTATTTTTCAGACGACCAGGCC
ACAGAATGGAAACAAATTGAGTCGGTAGAAAGTATCGGCCACCACTATCGCCTGCTGGTGCATATCCGCG
CCAGTGCGATTGAGATGAAAAAAGAGGAAAACTGA