SecReT6
Protein ID: 386605811
SecReT6 ID626
T6SS typei1
Gene symbol-
Locus tagUM146_16200
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]3361223..3362569 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDE1S3C9
KEGG IDelu:UM146_16200
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 6.60E-142, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|386605811|ref|YP_006112111.1| type VI secretion protein [Escherichia coli UM146]
MATMKNKVIWQEGLFALPQHFQQQQRHCEYLLTRRLDALGDFFWGFTELSINTELLAQGKIMIDRAAGCM
PDGTVFSIPDQDLLPEPFQPGTLSSKESHNIYLALPVISDVINEIQGLHSAGQGTERYRLTHTRVRDFHT
DEGDEQPVGLGQLIPRIVSGADDLSAMVTLPLCRILNKNATGALVLDNTFIPTIQAVRVSGLLGAFSGEV
QGLLATRAADLAGRIGSPEQSGIADVAEFMMLQMLNRYQMQFTHRSQLHTLHPEAFYRDLVGLLGELMTF
TEGNRLPCTVEPYNHRDLTATFTRTVIPELRRALNTVLVPRAQNLPLFFSEGTWIATINDPTLLQSCKLV
LAVRARMPYDQVQRQFIQQSKVAATDKIRSVVSVQVPGIPLHTLTAAPRQLPYHEGYVYFELEKGTPAWQ
DVIKAGALALHISGSFPDLNLQLWAIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|386602643|ref|NC_017632.1|:3361223-3362569 Escherichia coli UM146 chromosome, complete genome
ATGGCAACAATGAAAAACAAAGTGATCTGGCAGGAAGGGCTGTTTGCCCTGCCGCAGCATTTTCAGCAAC
AGCAGCGTCACTGCGAGTACCTGCTGACCCGTCGTCTGGATGCACTGGGTGATTTTTTCTGGGGTTTTAC
GGAACTCTCCATCAATACAGAACTGCTTGCCCAGGGCAAAATCATGATTGACCGTGCGGCGGGCTGTATG
CCTGACGGCACCGTATTCAGCATTCCCGACCAGGATCTGCTGCCGGAACCTTTCCAGCCGGGAACCCTTT
CATCGAAAGAGAGCCACAATATTTATCTGGCGCTGCCGGTGATAAGCGACGTGATCAATGAAATCCAGGG
GTTGCACAGCGCCGGTCAGGGTACGGAGCGTTACCGCCTCACCCATACCCGCGTCCGTGATTTTCACACT
GACGAAGGCGACGAACAGCCAGTCGGTCTGGGGCAGTTGATCCCCAGGATAGTCAGCGGCGCAGATGATC
TCAGCGCGATGGTGACTCTCCCCCTGTGCCGTATCCTCAATAAAAATGCCACCGGCGCGCTGGTGCTGGA
CAACACCTTTATTCCCACCATTCAGGCCGTCCGTGTCAGCGGGTTGCTCGGGGCATTCTCCGGCGAGGTG
CAGGGACTGCTTGCCACCCGCGCCGCTGACCTGGCCGGGCGCATTGGTTCGCCTGAACAGAGCGGGATCG
CCGATGTGGCCGAATTTATGATGTTGCAGATGCTTAACCGCTATCAAATGCAGTTCACGCATCGTTCCCA
ACTGCACACGCTGCATCCGGAAGCCTTCTACCGGGATCTGGTGGGGCTGCTGGGAGAACTGATGACCTTT
ACCGAAGGTAATCGCCTGCCCTGCACCGTGGAGCCGTATAATCACCGGGATCTTACCGCGACCTTCACCA
GAACCGTGATCCCGGAACTGCGGCGCGCGCTCAATACCGTACTGGTGCCGCGTGCGCAGAATCTGCCGTT
GTTCTTTTCAGAGGGGACCTGGATCGCCACCATCAACGATCCCACATTGTTGCAGTCCTGCAAGCTGGTA
CTGGCAGTGCGCGCCAGGATGCCCTACGACCAGGTACAACGCCAGTTCATCCAGCAGTCGAAAGTGGCCG
CTACCGACAAAATCCGCAGCGTGGTCAGCGTGCAGGTGCCGGGTATTCCGCTGCACACGCTTACCGCTGC
GCCACGTCAGTTGCCATACCACGAAGGTTATGTTTACTTCGAACTGGAAAAAGGCACCCCGGCCTGGCAG
GACGTGATAAAAGCGGGCGCACTGGCGCTGCATATCTCCGGCAGCTTCCCCGATCTGAACCTCCAGCTCT
GGGCTATAAGGGGATAA