SecReT6
Protein ID: 386605812
SecReT6 ID626
T6SS typei1
Gene symbol-
Locus tagUM146_16205
StrainEscherichia coli UM146
Repliconchromosome [GenBank: NC_017632] [Browse all T6SS(s) in this replicon]
Location [Strand]3362574..3363338 [+]
Producthypothetical protein
NoteTssL
UniProt IDE1S3D0
KEGG IDelu:UM146_16205
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.10E-62, Aligned region: 33..237
Protein Sequence: 254 a.a.     [Download]
>gi|386605812|ref|YP_006112112.1| hypothetical protein UM146_16205 [Escherichia coli UM146]
MSDMSEASVFPVEPESGTPGRQYRLALRGNSLNPMIDAATPLLGMVMRLSTMNSQAMPEHLFTQVVTDVQ
AVEQLLQEQGYEPGVIVSFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIR
EPVRYQDLLEFLYLCFSLGFRGRYKVAIQQQDEFERIYQRLHHALHKLRGDAPFPLLHQKNNIQGGRYQL
IRRLTIKHVLCGGLVVLTVFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 765 bp     [Download]
>gi|386602643|ref|NC_017632.1|:3362574-3363338 Escherichia coli UM146 chromosome, complete genome
ATGAGCGATATGAGTGAAGCGTCGGTTTTTCCCGTGGAGCCGGAGAGCGGAACACCAGGACGCCAGTACC
GTCTCGCCCTTCGCGGCAACAGCCTGAATCCAATGATTGACGCCGCCACGCCGTTGCTCGGCATGGTGAT
GCGTCTGTCCACTATGAACAGTCAGGCCATGCCGGAACATCTGTTTACCCAGGTAGTAACCGATGTCCAG
GCCGTAGAGCAACTACTCCAGGAACAGGGATACGAACCGGGCGTCATTGTTTCGTTCCGTTACATTCTCT
GCACGTTTATTGATGAAGCGGCGCTGGGCAACGGCTGGTCCAACAAAAACGAATGGATCAAACAGTCGCT
GCTGGTTCATTTTCATAACGAAGCCTGGGGCGGCGAGAAAGTGTTTATCCTGCTCGAACGCCTGATCCGG
GAGCCGGTACGTTACCAGGATCTGCTGGAATTTTTATACCTCTGTTTTTCGCTCGGCTTTCGCGGGCGCT
ACAAGGTTGCCATTCAGCAACAGGATGAATTTGAGCGGATCTACCAGCGCCTGCACCATGCCCTGCACAA
ACTGCGCGGTGACGCGCCATTTCCGCTACTTCATCAGAAGAACAACATACAGGGTGGGCGTTATCAGTTA
ATCCGACGACTGACCATCAAGCATGTACTGTGCGGCGGTCTTGTTGTGCTGACCGTATTTTATCTGTTTT
ATCTGCTGCGTCTGGACAGCCAGACACAGGATATTCTGCATCAGCTCAATAAATTACTCCGATAA