SecReT6
Protein ID: 386607515
SecReT6 ID629
T6SS typei1
Gene symboletsH2
Locus tagECW_m0217
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]240399..240881 [-]
ProductHcp-related protein
NoteTssD
UniProt IDE0J669
KEGG IDelw:ECW_m0217, ell:WFL_01040
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.90E-31, Aligned region: 6..145
Protein Sequence: 160 a.a.     [Download]
>gi|386607515|ref|YP_006123001.1| Hcp-related protein [Escherichia coli W]
MANISYLSLSGETQGLISAGCSTLDSVGNKAQPEHKDQIMVYALMHSISRSQNVNHHELIITKPVDKSSP
LLAKALSDNEKMAICEFILYRTSKAGIYQPYYKINLSKARISSIDFVTPHAVLEKELEPQERIAFIYEDI
SWEHTLAGTNAMSKWQDRVQ
 
Nucleotide Sequence: 483 bp     [Download]
>gi|386607309|ref|NC_017635.1|:c240881-240399 Escherichia coli W chromosome, complete genome
ATGGCAAATATAAGTTATTTATCTTTGAGTGGAGAGACACAAGGGCTGATTTCAGCAGGTTGCTCAACGC
TTGATTCTGTCGGAAACAAAGCGCAGCCAGAACATAAAGATCAGATCATGGTTTATGCGTTAATGCATTC
CATCTCAAGAAGTCAAAATGTCAATCATCATGAATTAATTATCACCAAACCGGTTGATAAATCCTCACCA
TTGCTGGCAAAAGCACTTAGTGACAATGAAAAAATGGCAATATGTGAATTTATACTCTACCGAACCAGTA
AAGCGGGTATTTACCAGCCTTATTATAAAATAAATCTGTCAAAAGCCCGAATATCAAGTATTGATTTTGT
CACACCGCATGCTGTCCTGGAAAAAGAACTGGAACCACAGGAGAGAATTGCCTTTATTTATGAAGATATT
TCCTGGGAGCATACGTTAGCCGGTACGAATGCAATGAGTAAATGGCAGGATCGTGTACAGTAA