SecReT6
Protein ID: 386607521
SecReT6 ID629
T6SS typei1
Gene symboletsU
Locus tagECW_m0223
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]250784..251545 [-]
ProductT6SS-associated protein
NoteTssL
UniProt IDE0J663
KEGG IDell:WFL_01070, elw:ECW_m0223
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.10E-62, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|386607521|ref|YP_006123007.1| T6SS-associated protein [Escherichia coli W]
MDEGSLSLPPFTGYDEKSQRDYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWLCFSLGFRGRYKVAAQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTIKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|386607309|ref|NC_017635.1|:c251545-250784 Escherichia coli W chromosome, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGATACGACGAAAAAAGCCAGCGCGACTATCATC
TCGCGCTTCGTGGCAACAGCCTGAATCCGATGATCGACGCGGCCACGCCGCTACTCGGTATGGTAATGCG
CCTTTCAACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACGGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAGCAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCGAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGAGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGCTCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGCACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGCCTGTACCACGTCCTGCATAAACT
ACGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAGGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACCATTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA