SecReT6
Protein ID: 386607523
SecReT6 ID629
T6SS typei1
Gene symboletsN
Locus tagECW_m0225
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]252884..253408 [-]
ProductOM lipoprotein
NoteTssJ
UniProt IDE0J661
KEGG IDelw:ECW_m0225, ell:WFL_01080
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.00E-33, Aligned region: 13..167
Protein Sequence: 174 a.a.     [Download]
>gi|386607523|ref|YP_006123009.1| OM lipoprotein [Escherichia coli W]
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNAEGESAAVDVQ
LVYLTDDSKLLAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPVKLDEKTQFIGVVAYFSDDQA
TEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
 
Nucleotide Sequence: 525 bp     [Download]
>gi|386607309|ref|NC_017635.1|:c253408-252884 Escherichia coli W chromosome, complete genome
ATGAACAGGAAGGCGTTTCTGGCCTGCGTGCTGATGTGCGTCATATTAACCGGCTGCGAAACGGCGAAAA
AAATCAGTGAGGTGATCAAAAACCCGGATATCCAGGTCGGGAGCCTGAAGGAGCAACCTTCGGAAATAAC
CGTCACCCTGCTGACCGAACCGGACACCAATACCAATGCGGAAGGTGAATCAGCCGCCGTGGATGTGCAA
CTGGTGTACCTGACTGACGACTCAAAATTGCTGGCAGCCGACTATGACCAGATAGCCAGTACGCCGCTAC
CGGATGTGCTGGGTAAAAACTATATCGACCACCAGGATTTCAACCTGTTGCCGGACACCATCAAAACCCT
GCCGCCGGTAAAGCTGGATGAGAAAACGCAGTTTATTGGTGTCGTGGCCTATTTCTCCGATGACCAGGCC
ACTGAATGGAAACAAATCGAGACGGTGGAAGGAACCGGCCACCATTACCGCCTGCTGGTGCATGTACGTC
AAAGCAGCATCGAAATGAAAAAAGAGGATGAATAA