SecReT6
Protein ID: 386607530
SecReT6 ID629
T6SS typei1
Gene symboletsS
Locus tagECW_m0232
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]259815..260315 [-]
ProductT6SS-associated protein
NoteTssB
UniProt IDE0J654
KEGG IDelw:ECW_m0232, ell:WFL_01115
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.50E-55, Aligned region: 7..161
Protein Sequence: 166 a.a.     [Download]
>gi|386607530|ref|YP_006123016.1| T6SS-associated protein [Escherichia coli W]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSSLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGLVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|386607309|ref|NC_017635.1|:c260315-259815 Escherichia coli W chromosome, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAGCGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCTCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACTGTCCCCGCCACCCTGAAGGGAAGCACAACAGACGATGAACTGAATG
TGGCGCTGAATATCAAATCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGTCTGGTGA
GCAATAAATAA