SecReT6
Protein ID: 386607532
SecReT6 ID629
T6SS typei1
Gene symboletsG
Locus tagECW_m0234
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]261741..263882 [+]
Productprotein VgrG
NoteTssI
UniProt IDE0J652
KEGG IDell:WFL_01130, elw:ECW_m0234
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.40E-62, Aligned region: 28..328
Phage_base_V [PF04717], Evalue: 6.10E-27, Aligned region: 366..458
Protein Sequence: 713 a.a.     [Download]
>gi|386607532|ref|YP_006123018.1| protein VgrG [Escherichia coli W]
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQFLSLEFQQILDKMAYLTIWQGDDVQR
RVKGMVTWFELGENDKNQMLYSMKVCPPLWRTGLRQNFRIFQNEDIESILGTILQENGVTEWSPLFSEPH
PSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSTDQSLVLCDTVRYLPESFEIPWNPNTRTEVSTLC
ISQFRYSAQIRPSSVVTKDYTFKRPGWAGRFDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGW
RNNAEVARGTSRSPEIWPGRRIVLTGHPQANLNREWQVVASDLHGEQPQAVPGRRGSGTTLDNHFAVIPA
DRTWRPQPLLKPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQESSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHHENRTPGSLPGTKTQMTIRSKTYKGSGFNELKFDDATGK
EQVYIHAQKNMNTEVLNNRTTDVINNHAEKIGNNQAITVTNNQIQNIGVNQIQTVGVNQVETVGSNQIIK
VGSNQVEKVGIIRALTVGVAYQTTVGGIMNTSVALLQSSQVGLHKSLMVGMGYSVNVGNNVTFSVGKTMK
ENTGQTAVYSAGEHLELCCGKARLVLTKDGSIFLNGTHIHLEGESDVNGDAPVINWNCGATQPVPDAPVP
KDLPPGMPDMRQF
 
Nucleotide Sequence: 2142 bp     [Download]
>gi|386607309|ref|NC_017635.1|:261741-263882 Escherichia coli W chromosome, complete genome
ATGTCAACCGGATTACGTTTCACGCTGGAAGTGGACGGCCTGCCACCGGATGCTTTTGCGGTGGTCTCCT
TTCATCTGAACCAGTCACTCTCTTCGCTTTTTTCCCTCGATCTCTCTCTGGTCAGCCAGCAGTTTCTCTC
CCTTGAATTCCAGCAGATCCTCGACAAAATGGCCTACCTGACGATATGGCAGGGCGATGACGTACAGCGC
CGGGTGAAAGGTATGGTGACCTGGTTTGAACTGGGGGAGAACGACAAAAACCAGATGCTGTACAGCATGA
AGGTGTGCCCACCGCTGTGGCGCACAGGGCTGCGCCAGAACTTCCGTATCTTCCAGAATGAGGACATCGA
AAGCATCCTCGGCACGATATTGCAGGAAAACGGGGTGACCGAGTGGAGCCCGCTGTTCAGCGAGCCACAT
CCTTCCCGTGAGTTTTGTGTCCAGTACGGTGAGACTGATTACGATTTCCTGTGCCGGATGGCGGCGGAGG
AAGGCATCTTCTTTTATGAGGAGCACGCGCAAAAAAGTACCGACCAGAGCCTGGTCCTGTGCGATACCGT
GCGTTATCTGCCGGAGTCCTTTGAGATCCCCTGGAATCCGAACACCCGTACCGAGGTGAGCACCCTCTGC
ATCAGCCAGTTTCGCTACAGCGCACAAATCCGCCCTTCTTCCGTGGTGACCAAAGACTACACCTTTAAAC
GACCCGGCTGGGCAGGGCGTTTTGATCAGGAAGGCCAGTACCAGGATTACCAGCGCACACAGTATGAAGT
GTATGACTACCCCGGACGTTTCAAGGGTGCCCACGGGCAGAACTTTGCCCGCTGGCAGATGGATGGCTGG
CGCAACAACGCAGAAGTGGCGCGCGGAACAAGCCGTTCGCCGGAGATATGGCCGGGACGGCGAATTGTGC
TGACGGGGCATCCGCAGGCGAACCTGAACCGGGAATGGCAGGTGGTGGCGAGCGATCTTCACGGCGAACA
GCCGCAGGCGGTACCGGGACGCAGGGGTTCAGGCACCACGCTGGATAACCACTTTGCGGTAATCCCGGCA
GACCGGACATGGCGGCCACAGCCGTTGCTGAAACCGCTGGTGGACGGCCCGCAGAGCGCCGTCGTGACGG
GACCGGCAGGCGAGGAAATCTTCTGTGATGAACATGGCCGCGTGCGGGTGAAATTTAACTGGGACCGCTA
TAACCCGTCAAACCAGGAAAGTTCATGCTGGATCCGTGTGGCACAGGCGTGGGCAGGCACCGGCTTTGGT
AACCTGGCGATACCGCGTGTGGGTCAGGAGGTCATTGTGGACTTCCTCAACGGCGATCCGGACCAGCCGA
TCATTATGGGGCGTACCTACCACCATGAAAACCGCACCCCCGGCAGCCTGCCGGGGACGAAGACGCAGAT
GACGATCCGCTCGAAAACCTATAAGGGCAGCGGGTTTAATGAACTGAAGTTTGACGATGCGACAGGGAAA
GAACAGGTCTACATCCACGCGCAGAAGAACATGAACACCGAGGTGCTGAATAACCGCACCACTGATGTGA
TAAACAACCATGCCGAAAAAATAGGTAACAACCAGGCGATCACCGTTACCAATAACCAGATCCAGAACAT
TGGCGTTAATCAGATACAGACGGTTGGTGTCAACCAGGTGGAAACGGTGGGCAGTAACCAGATTATCAAA
GTGGGATCAAACCAGGTTGAAAAGGTGGGGATCATTCGTGCGCTGACGGTGGGTGTGGCTTACCAGACGA
CGGTAGGCGGCATTATGAATACCTCGGTGGCGTTGTTGCAGTCCTCACAGGTAGGGCTGCATAAATCACT
GATGGTGGGAATGGGCTACAGCGTCAATGTGGGGAATAACGTCACCTTCTCGGTGGGCAAGACAATGAAG
GAAAACACCGGACAAACAGCAGTTTATTCTGCCGGTGAGCATCTTGAACTCTGCTGTGGTAAGGCAAGGC
TGGTGCTGACGAAGGACGGAAGCATATTTCTCAATGGTACGCACATTCATCTGGAAGGGGAGTCGGATGT
GAACGGTGATGCGCCAGTGATTAACTGGAACTGTGGTGCCACACAACCTGTACCGGATGCGCCTGTGCCG
AAAGATTTACCCCCCGGAATGCCGGATATGCGGCAATTTTGA