SecReT6
Protein ID: 386610179
SecReT6 ID630
T6SS typei2
Gene symbol-
Locus tagECW_m3029
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]3101953..3103491 [+]
Producthypothetical protein
NoteTssC
UniProt IDE0J231
KEGG IDelw:ECW_m3029, ell:WFL_14780
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-173, Aligned region: 88..508
Protein Sequence: 512 a.a.     [Download]
>gi|386610179|ref|YP_006125665.1| hypothetical protein ECW_m3029 [Escherichia coli W]
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDLWQNSETLADASPDERVTAAIHVLLSC
LAKSGENVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGTWFVVQRTDFRKNVRIELLDI
SKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASLISSYEFDNSPQDIALLRNISRVSAASHMPF
IGSVGPKFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSF
NYVEEVKGPDHEKYLWTNASFAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSE
VMIPETREFEFSNLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPGFFRVRLFAVP
HFQIEGMDINLSLVSQMPKAKA
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|386607309|ref|NC_017635.1|:3101953-3103491 Escherichia coli W chromosome, complete genome
ATGTCTGTACAACAAGAACATGCCACCTCTGAAACTGCAACACTGACCACCACTGAGTCCGGCGGCGTTT
ATCAGTCCCTGTTTGATAAAATTAATTTAACCCCGGTGTCTTCCATTCAGGAAATAGATTTATGGCAAAA
CAGCGAAACACTGGCGGATGCCTCACCCGATGAGCGCGTGACAGCGGCGATTCACGTTCTACTTTCCTGT
CTGGCGAAATCAGGCGAGAACGTGGTCAAGCTCGACAAGAGCCTGCTGGATTTTCATATCGACGATTTGG
ATCAGAAAATCAGTAAACAGCTTGATGCGGTCATGCACCATCCTGAATTCCAGAAAGTCGAGTCGCTGTG
GCGCGGCACATGGTTCGTCGTACAGCGCACTGATTTTCGCAAAAATGTCAGAATTGAATTGCTGGATATC
AGCAAAGAGCATCTGCGTCAGGATTTCGACGACTCCCCGGAAATCATTCAGAGCGGTTTATATCGTCATA
CATACATTCAGGAGTACGATACGCCGGGTGGCGAACCTGTTGCCTCATTAATTTCCAGCTATGAATTTGA
TAACAGCCCGCAGGATATTGCCCTGCTGCGCAATATTTCCAGAGTGTCTGCCGCTTCCCATATGCCTTTT
ATCGGTTCTGTCGGGCCGAAATTCTTCCTTAAAAATTCGATGGAAGAAGTCGCCGCGATTAAAGATATCG
GCAACTACTTTGACCGCGCAGAATATATTAAATGGAAATCGTTTCGTGATACCGATGACAGCCGCTATGT
GGGATTAGTGATGCCGCGAGTGCTGGGCCGTCTGCCCTATGGGCCGGACACGGTGCCGGTACGCAGCTTT
AACTATGTGGAAGAAGTCAAAGGCCCGGATCACGAAAAGTATCTCTGGACAAACGCCTCGTTCGCCTTTG
CCGCCAATATGGTGAAGAGCTTTGTGAATAATGGCTGGTGCGTGCAGATCCGTGGTCCACAAGCAGGTGG
CGCAGTGGCCGATCTGCCCATCCATCTTTACGATCTCGGCACCGGCAATCAGGTCAAAATTCCGTCCGAA
GTGATGATCCCGGAAACCCGCGAATTTGAATTTTCCAACCTTGGCTTTATTCCGCTCTCTTATTATAAGA
ATCGCGATTACGCCTGCTTCTTCTCGGCAAACTCTGCCCAGAAACCGGCGTTGTATGATACCGCTGACGC
CACCGCCAACAGCCGTATTAACGCCCGTCTGCCCTATATCTTCCTGCTGTCCCGCATTGCGCATTACCTG
AAAATCATCCAGCGCGAGAATATCGGTACCACCAAAGACCGCCGCGTACTGGAACTGGAACTGAACACCT
GGATCCGCACACTGGTGACGGAGATGACCGATCCGGGTGATGAACTGCAGGCGTCTCACCCGCTGCGCGA
CGGTAAGGTTATCGTGGAAGATATTGAGGACAATCCGGGCTTCTTCCGCGTCAGACTCTTTGCCGTGCCG
CATTTCCAGATTGAAGGGATGGATATCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCGAAAGCCTGA