SecReT6
Protein ID: 386610182
SecReT6 ID630
T6SS typei2
Gene symbol-
Locus tagECW_m3032
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]3105521..3107173 [+]
ProductPutative outer membrane protein/OmpA domain protein
NoteTagL
UniProt IDE0J228
KEGG IDell:WFL_14795, elw:ECW_m3032
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 4.10E-17, Aligned region: 437..533
Protein Sequence: 550 a.a.     [Download]
>gi|386610182|ref|YP_006125668.1| Putative outer membrane protein/OmpA domain protein [Escherichia coli W]
MRNTLKQAVVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTGDAGLSSLPPE
TYRQPVVLVCGDMSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTLRPAWASQLAVAYTVMPGMYR
DAAVLTGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPLPEKAHSPWLICTGGEIQVATSAETASPAQW
LTQTSTQERSQPLCYLLKAESLMQWLNLYVLAALNGPEAKCPPLAMAVGLHPSLPAVDNNLWQLWITART
GLTTDIADTGTDATLPFPDALLRRLPRQSGFTPLRRASVTMLGITTVAGIAALCLSATANHQLLRHIGDD
LHQFYAVPAEEFITKARRLSVLKDDAVMLDGYYREGEPLRLGLGLYPGEQIRQPVLRAIRDWRPPEQKME
VTASLQAQTVRLDSMSLFDVGQARLKDGSTKVLVDTLVNIRAKPGWLILVAGYTDATGDEKSNQQLSLRR
AEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLVPRSDACQDVK
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|386607309|ref|NC_017635.1|:3105521-3107173 Escherichia coli W chromosome, complete genome
GTGAGGAACACGCTGAAACAGGCCGTCGTGCTGTGGGGAATGGTGTTACTGCTGGTGCTGTGGTCGGTGT
TTATCAGTCCGTCTGGCGTACTGAGATGGGCCGGGGCGGCGGCTATCGTTCTGGCGGTTGCCGCGTTGCT
GATTTACCGGCGCAGGCAGGCGTGGACGGAGATGACCGGCGATGCCGGGTTGTCATCGCTGCCGCCGGAA
ACGTACCGACAACCGGTAGTGCTGGTCTGTGGCGATATGTCGGCGCATCTGTTCACTGACAGCCCGGTCC
GGCAGGTTTCAGAAGGGCTGTATCTGCATGTTCCCGATGAAGAACAGCTTGTGGCGCAGGTGGAGCGATT
ACTGACCCTTCGCCCGGCGTGGGCATCGCAGCTTGCCGTGGCGTATACCGTCATGCCCGGCATGTACCGG
GATGCGGCGGTTCTGACCGGACGACTGCGACGGTTCGCCCACAGTATGGCGACAGTGCGTCGCCGGGCGG
GCGTAAACGTCCCCTGGCTTCTCTGGAGCGGGCTGTCCGGCTCGCCCTTGCCGGAGAAGGCACATTCACC
GTGGCTTATCTGTACCGGCGGCGAAATTCAGGTAGCGACGTCTGCTGAAACCGCCTCCCCCGCGCAGTGG
CTCACGCAGACCAGCACACAGGAGCGCAGCCAGCCACTCTGTTACCTGCTGAAAGCCGAAAGCCTGATGC
AGTGGCTGAATCTTTATGTGCTGGCGGCACTGAACGGCCCGGAGGCGAAATGCCCGCCACTGGCGATGGC
CGTGGGGCTACACCCCTCGTTGCCTGCAGTGGATAACAACCTGTGGCAGCTGTGGATCACCGCCAGAACC
GGCCTGACGACGGATATCGCGGACACCGGCACAGACGCCACGCTGCCGTTTCCGGATGCCCTGTTACGGC
GGTTGCCGCGTCAGTCGGGCTTTACCCCGCTGCGACGGGCCAGTGTAACCATGCTGGGCATCACCACCGT
GGCGGGTATCGCCGCGCTGTGTCTGTCAGCCACGGCGAATCACCAGTTATTACGGCATATCGGTGACGAT
CTGCACCAGTTTTATGCCGTTCCGGCGGAGGAATTTATCACCAAAGCCCGTCGTCTGTCGGTGCTGAAAG
ACGATGCGGTCATGCTCGATGGGTATTACCGGGAAGGAGAACCGCTGCGTCTCGGTCTGGGGTTATACCC
CGGCGAACAAATCCGCCAGCCGGTATTACGCGCCATTCGTGACTGGCGTCCGCCTGAGCAAAAAATGGAA
GTGACAGCCTCGCTTCAGGCGCAGACCGTGCGTCTTGACAGTATGTCGCTGTTTGACGTCGGACAGGCCC
GCCTGAAAGACGGCTCGACAAAAGTGCTGGTGGACACACTGGTGAACATCCGGGCAAAACCGGGCTGGCT
TATCCTCGTGGCCGGATATACCGACGCCACCGGCGACGAAAAAAGCAATCAGCAGTTATCACTGCGACGT
GCCGAAGCGGTGCGTAACTGGATGCTGCAGACCAGCGACATCCCGGCCACCTGTTTTGCCGTACAGGGAC
TGGGTGAGAGCCAGCCTGCGGCGACCAACGATACGCCACAGGGCCGGGCAGTCAACCGGCGCGTCGAAAT
CAGTCTTGTTCCGCGTTCTGACGCCTGTCAGGACGTGAAATAA