SecReT6
Protein ID: 386610194
SecReT6 ID630
T6SS typei2
Gene symbol-
Locus tagECW_m3046
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]3126751..3128109 [+]
Producttype VI secretion-associated protein, family
NoteTssA
UniProt IDE8Q0T6
KEGG IDelw:ECW_m3046
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.20E-12, Aligned region: 1..42
ImpA-rel_N [PF06812], Evalue: 2.20E-12, Aligned region: 375..393
Protein Sequence: 452 a.a.     [Download]
>gi|386610194|ref|YP_006125680.1| type VI secretion-associated protein, family [Escherichia coli W]
MRIATYYIWARLHRDGERGLAEGLALLAGLVERFGTQLLPSRPASRKMALEWLAGEKMLDSLARYPEVAK
EDFANIVAALNQLTVSFAAWPEEQQSPSLMPLINALESRLAQSGGMNAVVPQNSSSIPAASSPVDAPQVQ
TITSGRDLLDQAKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAPPRTESRNQLKRLYA
QQNWTELLEQADLMFSTGVSHFWLDIQWYLHQALTKAGAPWDRWTAVIRQDLALLLERLPGLENLAWNDG
TPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMADSQGVEAALGWIQTRPGIT
TARQRLLLRLLMARVAEQYGKNEMALLLLEELDTVAQGLTLTQWEPDLLFEVKARQLKLLRLRAHRYADK
ALLNRKMEILLGTLVTIDPVRAAVLCDTQHKD
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|386607309|ref|NC_017635.1|:3126751-3128109 Escherichia coli W chromosome, complete genome
GTGCGCATCGCCACTTACTACATCTGGGCGCGACTGCACCGCGACGGTGAGCGCGGACTGGCTGAGGGGC
TGGCGCTGCTGGCCGGACTGGTGGAACGCTTCGGTACGCAACTGCTGCCCTCGCGACCGGCCAGCCGGAA
AATGGCGCTGGAGTGGCTGGCAGGGGAAAAGATGCTCGACAGCCTTGCCCGCTACCCGGAAGTGGCAAAA
GAGGATTTTGCGAACATTGTTGCCGCTCTTAATCAACTGACGGTTTCCTTCGCCGCATGGCCCGAAGAAC
AACAGTCTCCCTCCCTGATGCCGCTGATTAACGCGCTGGAATCGCGTCTGGCGCAGTCGGGTGGGATGAA
CGCGGTGGTGCCGCAAAACAGCAGCAGCATACCTGCAGCGTCATCCCCGGTGGATGCGCCACAGGTACAG
ACCATCACCTCCGGGCGCGACCTGCTCGACCAGGCGAAAGTGCTGGCCCGTTATCTGAACGAACAGCCGC
AGGGCTGGCTTTCGGCGCACCGGCTGATGAAAACCCTGCGCTGGGACACAGTGCATGAACTGCCGCCGGA
TGTGGACGGCAAAACCCGGCTGGCCCCGCCGCGCACCGAGTCACGCAACCAGCTTAAGCGGCTGTATGCC
CAGCAGAACTGGACGGAACTGCTGGAGCAGGCCGACCTGATGTTCAGCACCGGCGTCAGCCATTTCTGGC
TGGACATCCAGTGGTATCTGCATCAGGCGCTGACTAAGGCGGGCGCACCGTGGGACAGGTGGACAGCCGT
TATCCGTCAGGACCTGGCGCTTCTGCTGGAGCGCCTGCCGGGGCTGGAAAATCTGGCATGGAACGACGGC
ACACCGTTCGCCGACGAGGTGACGCGCAACTGGATAGCGCAGCAGGTCATGATGCGGGAAGACGGCGCAT
GGCTTGCGGGGAAAGCCGCTGTGCCGACAGACGACGCCACAAATGACGTACTGGCGCTGGAGCCGGAAGC
ACTGGAGATGGCAGACAGTCAGGGCGTGGAAGCGGCTCTGGGCTGGATACAGACCCGTCCGGGCATCACC
ACGGCACGCCAGCGCCTGTTATTGCGACTGCTGATGGCGCGGGTGGCGGAACAGTACGGTAAAAACGAAA
TGGCGCTCCTGCTGCTGGAAGAACTGGATACCGTCGCACAGGGGCTGACGCTGACGCAGTGGGAGCCGGA
CCTGCTGTTTGAGGTAAAAGCCCGACAACTGAAACTGCTGCGCCTGCGGGCGCACCGCTATGCGGATAAA
GCCCTGCTGAACCGAAAAATGGAAATCCTGCTGGGAACGCTGGTGACAATCGATCCGGTACGGGCAGCGG
TATTGTGTGATACGCAACATAAGGACTGA

Protein ID: 386610204
SecReT6 ID630
T6SS typei2
Gene symbol-
Locus tagECW_m3057
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]3135521..3136897 [+]
Producthypothetical protein
NoteTssA
UniProt IDE0IWK7
KEGG IDelw:ECW_m3057, ell:WFL_14930
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 117..127
DUF3702 [PF12486], Evalue: 3.00E-48, Aligned region: 306..449
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 42..100
ImpA-rel_N [PF06812], Evalue: 2.00E-15, Aligned region: 358..376
Protein Sequence: 458 a.a.     [Download]
>gi|386610204|ref|YP_006125690.1| hypothetical protein ECW_m3057 [Escherichia coli W]
MASNANFISQFVMGGDPCTYKESGELQAEMSKLTHPARPDVDWRRVEKLSLALFRQNGVELQTQVCYVLA
ITRRQGLAGMADGLGSLDILLQRWADFWPVQVHSRISLLSWVTEKMQQALRTLDIQYQDLPQIYRCVQHL
SAIETTLQQCELWHMTKLDVLAGQFRNTALRLERLAPQGAETTITPPELPRREMKQPEKSEESPQPVFAT
RPAQQNDKDASPSAPSPEISRQRTWPIFMAGMVVMACLGGTGLWGWSQLNQPDALIQRIQLSVMPLPQSL
ESGELAKLDVKDKALLAQDRTIAASQMQLEQLNKLPARWPLEQGYRQLRQLDALWPDNPQVRALNAQWRK
QRELSALSTEALNGYAQAQSQLQRLSAQLDALDERKGRYLTGSELKTAVYGIRQSLKEPPLEELLRQLEE
QKQTGEVSPTLLTQIDTRLNQLLNRYVILLDTKVEQSQ
 
Nucleotide Sequence: 1377 bp     [Download]
>gi|386607309|ref|NC_017635.1|:3135521-3136897 Escherichia coli W chromosome, complete genome
ATGGCAAGTAACGCGAATTTTATCAGCCAGTTCGTCATGGGCGGCGATCCCTGTACTTATAAGGAATCCG
GTGAACTACAGGCTGAAATGAGTAAACTGACTCACCCGGCCCGACCTGATGTGGACTGGCGTCGGGTGGA
AAAACTCAGCCTCGCGCTGTTCCGGCAAAATGGCGTGGAATTACAGACGCAGGTCTGTTACGTACTGGCG
ATAACCAGACGGCAGGGGCTGGCAGGGATGGCAGACGGACTCGGTTCACTGGACATACTGCTCCAGCGCT
GGGCTGACTTCTGGCCGGTACAGGTACATTCCAGAATATCACTGCTCAGTTGGGTCACAGAAAAAATGCA
GCAGGCACTGAGAACGCTGGATATTCAGTATCAGGATCTGCCGCAGATTTACCGTTGTGTACAGCATCTT
TCCGCCATCGAAACCACGCTGCAACAGTGTGAACTGTGGCATATGACGAAACTGGATGTGCTGGCCGGGC
AGTTTCGTAATACGGCGCTACGTCTGGAGCGGCTGGCACCACAGGGAGCGGAAACCACTATCACTCCCCC
TGAATTACCCCGCCGGGAAATGAAGCAACCAGAAAAGTCAGAAGAAAGTCCACAGCCGGTTTTTGCAACC
AGACCCGCTCAGCAAAACGATAAGGATGCCAGTCCATCCGCGCCATCCCCTGAAATCTCCCGGCAGCGGA
CATGGCCGATATTTATGGCCGGAATGGTTGTGATGGCCTGTCTCGGCGGAACAGGATTATGGGGCTGGTC
GCAGCTTAATCAGCCGGACGCACTAATCCAGCGAATACAACTGTCTGTCATGCCATTACCGCAGTCGCTG
GAGAGCGGCGAGCTGGCAAAGCTGGATGTAAAGGATAAGGCGCTGCTGGCTCAGGACAGAACAATTGCGG
CAAGTCAGATGCAACTGGAGCAGTTAAACAAATTGCCTGCCCGCTGGCCACTGGAGCAGGGATATCGCCA
GCTACGCCAGCTTGATGCCCTGTGGCCGGATAATCCTCAGGTCAGAGCGCTGAACGCGCAGTGGCGTAAA
CAGCGGGAGCTGAGCGCCCTGTCCACAGAGGCATTGAATGGCTACGCACAGGCGCAGAGCCAGCTACAGC
GCCTGTCGGCGCAGCTGGATGCACTGGATGAGCGTAAGGGGAGATATCTGACCGGTTCGGAACTAAAAAC
GGCGGTGTACGGCATCCGGCAGTCGTTAAAGGAGCCGCCGCTGGAAGAACTGCTTCGGCAACTGGAAGAG
CAAAAACAGACCGGAGAGGTTTCGCCGACGCTGTTGACGCAAATTGATACCCGGTTAAATCAGTTGCTGA
ATCGCTATGTAATTTTACTGGATACGAAGGTGGAACAAAGTCAGTAA