SecReT6
Protein ID: 386610195
SecReT6 ID630
T6SS typei2
Gene symbol-
Locus tagECW_m3047
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]3128115..3128591 [+]
Producthypothetical protein
NotePAAR
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 5.20E-12, Aligned region: 9..66
Protein Sequence: 158 a.a.     [Download]
>gi|386610195|ref|YP_006125681.1| hypothetical protein ECW_m3047, partial [Escherichia coli W]
MGTGYFLVRGDKTTCGGKIIEGADDHTIMGIPQARDMDRVTCGRYPGMFIIVGGVPETDIHGRLMAGTLD
SQSSCPCKARFIASMMDDTYETDDGGSEAEQHAQSAKKDLTSGSDSSSDDVKLDYRIKLSGNKILTPLNI
PDYKEMISGGSTKNVVVK
 
Nucleotide Sequence: 477 bp     [Download]
>gi|386607309|ref|NC_017635.1|:3128115-3128591 Escherichia coli W chromosome, complete genome
ATGGGAACAGGCTACTTTCTGGTCAGGGGGGACAAAACCACCTGCGGCGGGAAGATTATTGAAGGCGCGG
ACGACCATACGATCATGGGTATCCCACAGGCACGGGATATGGACCGGGTCACCTGCGGCAGATATCCGGG
AATGTTTATTATTGTGGGCGGCGTTCCTGAAACAGATATTCACGGCAGGCTGATGGCGGGGACGCTGGAC
AGCCAGAGCAGTTGCCCCTGTAAGGCACGGTTTATTGCGTCGATGATGGATGATACGTATGAGACGGATG
ACGGGGGAAGTGAAGCGGAACAACATGCGCAGTCGGCGAAAAAGGATCTGACTTCTGGTTCTGATTCATC
CTCTGATGATGTAAAACTGGATTACAGAATTAAATTATCAGGTAATAAGATACTGACGCCACTGAATATA
CCTGATTATAAAGAAATGATAAGCGGTGGTAGTACGAAGAATGTAGTGGTCAAGTAA