SecReT6
Protein ID: 386610200
SecReT6 ID630
T6SS typei2
Gene symbol-
Locus tagECW_m3053
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]3131769..3133529 [+]
Producthypothetical protein
NoteTssF
UniProt IDE0IWL1
KEGG IDelw:ECW_m3053, ell:WFL_14910
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.00E-182, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|386610200|ref|YP_006125686.1| hypothetical protein ECW_m3053 [Escherichia coli W]
MDDLTQRYYEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGSLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVELSTDHRQMKQSETLSDFQVLSRPVGERRTRCFYSATRDITLHPLAL
PDVSLQYEPDGRSVIRLRFECGPLVGDWSQIDLSRLPLYLNAGSPVACALHRALTLGTQQFWLRLPGQDR
RTLDAHFSPLGFEDNDRLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLELVAWPEGITGFEIDVVLNE
NWPHDLPFDSDNIRLHCVPVINLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQA
YVPFSSFRHRGGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDADRMLEDETLSLSLTGTNGHLPR
KALQSTLLDRPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEILRGTLALYDW
TESEMNRRRLEAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDITLFGELLHRFFALYADIHLF
TQLTLILQPTGKCLQWTEHHSQRVPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|386607309|ref|NC_017635.1|:3131769-3133529 Escherichia coli W chromosome, complete genome
ATGGACGACTTAACCCAACGCTACTACGAAGCCGAAATGCGCTACCTGCGTGAAGCGGGGAAAGAATTTG
CGCAGGCTTACCCCGACCGCGCCGCGATGCTCAATCTTGATAAACCCGGCGCACGCGATCCCTATGTGGA
ACGCCTGTTCGAAGGCTTTGCTTTTTTAATGGGCAGCCTGCGCGAGAAGCTGGACGACGATCTGCCGGAG
CTGACTGAAGGGCTGGTCAGCCTGCTGTGGCCTCACTACCTGCGAACTATCCCGTCACTTTCCGTGGTTG
AACTGTCGACAGATCACCGGCAGATGAAGCAGAGCGAAACGCTGAGCGATTTTCAGGTATTGTCGCGCCC
TGTTGGCGAGCGCAGAACCCGCTGTTTCTACAGCGCCACGCGGGATATCACGCTGCATCCGCTGGCGTTG
CCGGACGTGTCATTGCAATATGAACCGGACGGACGTTCGGTTATTCGTCTGCGCTTTGAATGCGGCCCGC
TGGTCGGTGACTGGTCACAGATCGATTTATCCCGCCTGCCGCTCTATCTCAATGCCGGCAGTCCGGTGGC
CTGTGCGCTGCACCGGGCTTTAACGCTTGGTACGCAGCAGTTCTGGTTGCGTCTGCCGGGGCAGGATCGC
CGGACGCTTGACGCACACTTTTCCCCGTTGGGCTTTGAGGATAATGACAGGCTCTGGCCAAAAGGCGAGT
CGGCGTTCAGCGGCTACCAGTTGCTGCTGGAGTATTTCACCTTCCGCGAGAAGTTTATGTTTGTGGCACT
CAACGGGCTTGAGCTGGTTGCATGGCCGGAGGGGATAACCGGCTTTGAGATTGACGTGGTGCTGAACGAG
AACTGGCCTCACGACCTGCCGTTTGACAGCGATAATATCCGTCTGCACTGCGTGCCGGTCATCAATCTGT
TCCCGCTCGAAGCCGATCCGTTACACCTTTCGCCACTGGAAAACGAATTTCTGCTACGCCCGATGCGCAT
TCAGGACGGGCATACCGAGATTTATTCCGTCGACAACATTATTTCTTCGCGCCATACCGGCAGTCAGGCG
TATGTCCCCTTCTCCAGCTTTCGTCACCGGGGCGGGATGCTGCGCCACGATGCGCCGGAACGCTATTACC
ACACGCGGGTAAAGCGCGGCCCTTCCGGTCTGCATGACACCTGGCTGATTCTGGGCGGTGATGCGTTTGA
TGCTGACCGGATGCTGGAGGATGAAACGCTCTCTTTAAGCCTGACCGGTACTAACGGGCATCTTCCCCGT
AAGGCTTTACAGAGCACGCTGCTCGATAGGCCAGTTCATGCCTCACAGAACGTCCTGCGGGTGCGCAACC
TGTGCGCCCCAACGCAGCCCTGCTATCCCCCGGCGCGTGACCGCTTCCACTGGCGGGTGCTCAGCCACCT
TGGTTCTAACTTTTTATCGATGATGGATAACGCCGAAATTCTGCGCGGAACGCTGGCGCTGTACGACTGG
ACCGAAAGCGAGATGAACCGCCGTCGTCTGGAGGCGATTGTCGACGTTCAGCACAGCCTGATACAGCGTT
TTGAAAGAGGCTTTCTGCTGCGTGGCGTGGATATTCAGGTGACGCTGGACAGTAACGGCTTTGCCGGAGA
AGGTGATATCACGCTGTTTGGTGAACTGCTGCACCGCTTTTTCGCACTGTATGCCGATATCCACTTATTC
ACTCAACTGACCTTAATTCTGCAACCTACAGGAAAGTGCCTGCAATGGACAGAGCATCACAGCCAGCGCG
TACCGGGCTGA