SecReT6
Protein ID: 386610203
SecReT6 ID630
T6SS typei2
Gene symbol-
Locus tagECW_m3056
StrainEscherichia coli W
Repliconchromosome [GenBank: NC_017635] [Browse all T6SS(s) in this replicon]
Location [Strand]3135093..3135521 [+]
Producthypothetical protein
NoteTssE
UniProt IDE0IWK8
KEGG IDelw:ECW_m3056, ell:WFL_14925
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-16, Aligned region: 25..114
Protein Sequence: 142 a.a.     [Download]
>gi|386610203|ref|YP_006125689.1| hypothetical protein ECW_m3056 [Escherichia coli W]
MSTPSLYEMLTFSFSGELPLEQVSERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLSLIHQGMVAGI
HGLMRQIEETLLRYEPRLSQIQVELLPQPRPGYLNYLIHAQLPDTGWIRFDGVFSPEGRIVLRHLKQQER
AY
 
Nucleotide Sequence: 429 bp     [Download]
>gi|386607309|ref|NC_017635.1|:3135093-3135521 Escherichia coli W chromosome, complete genome
ATGTCGACACCTTCCTTATATGAAATGCTGACGTTCAGTTTCAGCGGCGAGTTACCACTGGAACAGGTCA
GCGAGCGGGATCAGCTTATCCTTTCCGTGATGGACAATATGCAACGCATTATCAACTGTCGGGCAGGCAC
ACTGGCGCATTTGCCGGATTACGGTCTGCCGGATCTCAGTCTGATCCATCAGGGTATGGTTGCGGGTATT
CATGGCCTGATGCGTCAGATTGAAGAAACGCTGCTGCGTTATGAACCACGCCTGAGTCAGATACAGGTGG
AGTTACTCCCCCAGCCCCGTCCGGGGTATCTTAATTACCTGATCCACGCGCAGCTTCCCGATACCGGCTG
GATACGCTTTGATGGCGTGTTTTCTCCGGAAGGACGAATTGTTCTGCGTCATCTCAAACAGCAGGAGCGG
GCGTACTGA