SecReT6
Protein ID: 386612383
SecReT6 ID631
T6SS typei1
Gene symbolclpB
Locus tagUMNK88_232
StrainEscherichia coli UMNK88
Repliconchromosome [GenBank: NC_017641] [Browse all T6SS(s) in this replicon]
Location [Strand]250097..252862 [-]
ProductATP-dependent chaperone protein ClpB
NoteTssH
UniProt IDF4M3L2
KEGG IDeun:UMNK88_232
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 260..260
AAA_2 [PF07724], Evalue: 1.40E-38, Aligned region: 644..805
AAA [PF00004], Evalue: 6.60E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 6.60E-17, Aligned region: 650..767
AAA [PF00004], Evalue: 6.60E-17, Aligned region: 779..841
AAA_5 [PF07728], Evalue: 7.10E-14, Aligned region: 222..245
AAA_5 [PF07728], Evalue: 7.10E-14, Aligned region: 649..769
ClpB_D2-small [PF10431], Evalue: 1.20E-12, Aligned region: 811..887
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 21..46
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 267..300
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 620..690
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 715..743
AAA_22 [PF13401], Evalue: 1.90E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.90E-07, Aligned region: 446..483
AAA_22 [PF13401], Evalue: 1.90E-07, Aligned region: 648..683
AAA_25 [PF13481], Evalue: 5.30E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 5.30E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 5.30E-05, Aligned region: 644..678
AAA_25 [PF13481], Evalue: 5.30E-05, Aligned region: 777..841
AAA_29 [PF13555], Evalue: 8.30E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 8.30E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 8.30E-05, Aligned region: 647..674
AAA_14 [PF13173], Evalue: 9.60E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 9.60E-05, Aligned region: 649..739
NACHT [PF05729], Evalue: 0.0001, Aligned region: 222..249
NACHT [PF05729], Evalue: 0.0001, Aligned region: 283..345
NACHT [PF05729], Evalue: 0.0001, Aligned region: 453..453
NACHT [PF05729], Evalue: 0.0001, Aligned region: 650..678
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 643..671
DUF258 [PF03193], Evalue: 0.00031, Aligned region: 198..239
DUF258 [PF03193], Evalue: 0.00031, Aligned region: 650..668
AAA_18 [PF13238], Evalue: 0.006, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.006, Aligned region: 650..685
Protein Sequence: 921 a.a.     [Download]
>gi|386612383|ref|YP_006132049.1| ATP-dependent chaperone protein ClpB [Escherichia coli UMNK88]
MIQIDLPPLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTMTDASDTLLARYAKNMTADARNGRLDPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGTSVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYEQSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESEQDNTGAVPADEADREQPEETAETVSPVQRLAQ
LTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLTKWLGDTIKGQDLAIASLHK
HLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPG
YVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGY
QVIVEHADDPETMQEVLYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFGAEVV
IEPEVTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAVDGTFTADVEDAQN
DESVTKDETVL
 
Nucleotide Sequence: 2766 bp     [Download]
>gi|386612163|ref|NC_017641.1|:c252862-250097 Escherichia coli UMNK88 chromosome, complete genome
ATGATCCAGATTGATCTTCCCCCGCTGGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCTGAATGTATGAGTCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTCATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
CTGACGGTAGAGAACTACACAACCGCCCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTG
AGTGGCTTAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTT
GCTGCTGGCCCTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACAATGACGGACGCCTCTGACACCCTGCTTGCCCGCTATGCCAAAAACAT
GACCGCAGACGCCCGTAACGGCAGGCTTGACCCGGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGAAGCGGGCGTGGGCAAAAGCGCAC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAGCTGAAAAACACCGATATCAT
GACCCTTGACTTGGGCGCATTGCAGGCCGGGACGTCGGTGAAGGGTGAATTCGAAAAACGTTTCAAAGGG
CTGATGGCGGAGGTCATTTCCTCCCCGGTGCCGGTCATTCTGTTTATCGACGAAGCACATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTCAAACCGGCGCTGGCGCGCGGCGAGCT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAAAAAGATGCCGCCCTGTCGCGC
CGCTTCCAGTTGGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGCGGTCTGTCGG
CGGTCTATGAACAGTCTCACGGCGTGCTGATTGATGATGACGCCTTGCAGGCCGCTGCGACATTAAGCGA
GCGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACAGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCCTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACCGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAACAGGATAATACCGGTGCCGTACCGGC
TGATGAGGCCGACAGAGAACAACCGGAAGAGACCGCTGAAACAGTTTCCCCGGTACAGCGGCTGGCCCAG
CTCACTGCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTCTCCCCGCACGTCGATAAAAAACAGA
TTGCGGCGGTGATTGCCGAATGGACCGGCGTGCCGCTCAACCGCCTGTCGCAGAATGAAATGTCGGTCAT
CACCGACCTGACGAAATGGCTGGGTGACACCATCAAAGGCCAGGACCTGGCGATTGCCAGCCTGCATAAG
CATCTACTGACCGCACGCGCCGACCTGCGTCGTCCGGGACGCCCGCTCGGTGCGTTCCTGCTGGCTGGCC
CCAGCGGTGTGGGTAAAACCGAAACCGTCCTGCAACTGGCAGAGCTGCTCTACGGCGGTCGCCAGTACCT
GACCACCATCAATATGTCCGAATTCCAGGAGAAACACACCGTCTCGCGGCTGATTGGTTCGCCTCCGGGC
TACGTTGGCTACGGTGAAGGCGGCGTACTGACCGAAGCGATTCGTCAGAAACCCTACTCGGTAGTACTGC
TCGATGAAGTGGAAAAAGCGCACCCGGATGTGCTCAACCTGTTCTACCAGGCGTTCGATAAGGGCGAAAT
GGCAGACGGTGAAGGCCGCCTGATTGACTGCAAAAATATCGTCTTCTTCCTGACGTCCAACCTCGGCTAC
CAGGTAATAGTCGAGCATGCCGATGACCCGGAAACCATGCAGGAAGTACTGTATCCGGTGCTGGCCGACT
TCTTCAAACCTGCCCTGCTGGCGCGTATGGAAGTGGTGCCGTATCTGCCGCTGTCGAAAGAGACGCTCGC
CACCATTATCGCCGGAAAACTGGCCCGTCTGGATAACGTGCTGCGCAGTCGCTTTGGTGCAGAAGTGGTC
ATTGAACCGGAAGTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCGCGAGGATGCTGG
AATCGGTCATCGATGGCGACATGCTACCGCCGCTCTCGCTGCTGCTGTTGCAGAAAATGGCGGCTAACAC
GGCGATTGCCCGGATTCGGTTGTCGGCAGTGGACGGCACATTTACGGCAGACGTGGAAGATGCTCAGAAC
GACGAGTCCGTCACAAAGGATGAAACGGTTTTATGA