SecReT6
Protein ID: 386612384
SecReT6 ID631
T6SS typei1
Gene symbol-
Locus tagUMNK88_233
StrainEscherichia coli UMNK88
Repliconchromosome [GenBank: NC_017641] [Browse all T6SS(s) in this replicon]
Location [Strand]252871..253632 [-]
Producthypothetical protein
NoteTssL
UniProt IDF4M3L3
KEGG IDeun:UMNK88_233
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.00E-62, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|386612384|ref|YP_006132050.1| hypothetical protein UMNK88_233 [Escherichia coli UMNK88]
MDEGSLSLPPFTGHDEKSQRNYHLALRGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWICFSLGFRGRYKVAAQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTVKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|386612163|ref|NC_017641.1|:c253632-252871 Escherichia coli UMNK88 chromosome, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGACACGACGAAAAAAGCCAGCGCAACTACCATC
TCGCGCTTCGTGGCAACAGCCTGAATCCGATGATCGACGCGGCCACGCCGCTACTCGGTATGGTAATGCG
CCTTTCAACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACAGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAGCAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCAAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGCGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGATCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGCACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGTCTGTACCACGTTCTGCATAAACT
GCGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAGGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACTGTTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA