SecReT6
Protein ID: 386612392
SecReT6 ID631
T6SS typei1
Gene symbol-
Locus tagUMNK88_241
StrainEscherichia coli UMNK88
Repliconchromosome [GenBank: NC_017641] [Browse all T6SS(s) in this replicon]
Location [Strand]261643..261867 [-]
Producthypothetical protein
NoteTssC
UniProt IDF4M3M1
KEGG IDeun:UMNK88_241
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 0.0011, Aligned region: 39..71
Protein Sequence: 74 a.a.     [Download]
>gi|386612392|ref|YP_006132058.1| hypothetical protein UMNK88_241 [Escherichia coli UMNK88]
MTAHKNISGTYHLSVADILQVVYQVCFSPSVEINQDGVAALITTLDRRISDLLDEIIHFCEFQQSASHWQ
RVLH
 
Nucleotide Sequence: 225 bp     [Download]
>gi|386612163|ref|NC_017641.1|:c261867-261643 Escherichia coli UMNK88 chromosome, complete genome
ATGACGGCACACAAAAATATCTCCGGGACATACCACCTCTCTGTTGCAGACATTCTGCAGGTGGTTTACC
AGGTATGTTTCAGCCCGTCCGTTGAAATCAACCAGGATGGTGTGGCTGCGCTGATTACAACACTGGATCG
CCGTATCAGTGATCTATTGGATGAGATTATCCATTTTTGTGAGTTTCAGCAGAGCGCGTCGCACTGGCAG
CGCGTACTTCACTGA